(data stored in ACNUC7421 zone)

EMBL: CP000675.PE448

CP000675.PE448       Location/Qualifiers
FT   CDS_pept        complement(485924..486943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2954"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2954"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56855"
FT                   /protein_id="ABQ56855.1"
FT                   /translation="MPISNAFLKLFSEFVDNYARNGTPSFYHWAKEQNHEVINKFFHEL
FT                   LEIIKSNTETFHDVSIIEHLNATVLLSAKTNPYLLDCWISFITKYNAETNSFTPIGASM
FT                   HIKIGPEGTPSERIIRELKESLVMTQQAFILAQKANATEVDSLKRQLERTKLENERLVT
FT                   QNQFLKDQVRAEKTFADINPQINNARHQLSALTELIQTLSEITNAKPKIETVSSLSIPA
FT                   VTENKSELLKENSCSVAPVSKEVTPAISQEPKKRPVPPPPNDMDSQALFPNIPPKEDVS
FT                   IKVTIPSMPKPNSTQPVAKNSGFFSGDGFLKELNAKIKERKERPKDEPHTTPVEKKNL"
     atgcctatca gtaatgcctt tcttaagtta ttcagtgaat ttgttgataa ttatgcgcgc        60
     aatggcaccc cttcatttta tcattgggca aaggaacaaa accatgaagt cattaacaaa       120
     tttttccatg agcttttgga aattattaaa tcaaacacag aaacatttca tgatgtcagt       180
     atcatagagc accttaatgc tacagtacta ttatcagcaa agaccaatcc ctacttactc       240
     gattgttgga tttcatttat tactaaatac aatgctgaaa ccaacagttt taccccaata       300
     ggggcttcga tgcacattaa aattgggcca gaaggcacgc catccgaacg gataataagg       360
     gagctcaaag aaagtctggt catgacgcaa caagcgttta ttttagccca aaaggctaat       420
     gctacggaag ttgactcttt aaaaagacaa cttgagcgaa caaagctaga aaacgagcgc       480
     ttagtcacac aaaatcagtt tctaaaggat caagtcaggg cagaaaaaac atttgcagac       540
     attaacccac agattaacaa tgcccggcat caactcagtg ctttaacaga attaatacaa       600
     actctaagcg aaatcacaaa tgccaaaccc aaaatagaaa ctgtatcttc gttatccatt       660
     ccagctgtta cagaaaataa gtctgaactt ctaaaggaaa attcatgctc tgtcgcccct       720
     gtatccaagg aagttactcc tgcaatcagt caagaaccga aaaaaagacc agttccaccg       780
     ccccccaatg atatggatag tcaagcatta ttccccaata taccccctaa agaagatgtg       840
     tctataaaag ttacaatacc gtccatgccc aaaccaaatt caacccagcc cgttgcaaaa       900
     aattcaggct tcttttcagg cgatggtttt ttaaaagaat taaatgcaaa aattaaagaa       960
     agaaaggaac gcccaaaaga tgagccacat accactcccg tcgaaaaaaa aaatctctag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page