(data stored in ACNUC7421 zone)

EMBL: CP000675.PE45

CP000675.PE45        Location/Qualifiers
FT   CDS_pept        complement(51574..52434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0045"
FT                   /product="Protein of unknown function UPF0187"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54045"
FT                   /protein_id="ABQ54045.1"
FT                   /translation="MISYLFSEVHFTHALKKVLGISVLVGVYSAIIYFWFEQDNLHSSN
FT                   WLSYSQSVFGIILGLLLVFRSNRAYERWWEARTLWGQLVNASRNLAIKIRVLLSPNTDE
FT                   AKKFSELINTFCEVLAIHLRQKSTRDDFKKFLKMVSLPSHVPSYVAQELYCELSEKTKA
FT                   SKRLNLWLLDNEFSKFMDICGGCERIKNTFISLSFRVFVKHVFIIFILFLPCSLIDTLG
FT                   VWAIPATIIITYLIIAIEGIARNLEEPFGLTEDHLNLGAITESIRESVNEVLLGQKSNE
FT                   ESNSI"
     atgattagct atttattttc agaagtacat ttcacccatg ctctgaagaa agtacttgga        60
     attagtgttt tggttggtgt ttacagcgcc attatttatt tttggtttga gcaagataac       120
     ttgcattcca gtaactggct atcctattcg caaagcgtat ttggcatcat tttaggtttg       180
     cttttggttt ttagaagcaa tcgggcttat gaacgttggt gggaagcgag aaccctgtgg       240
     ggtcaattag tcaatgccag tcgtaattta gcaataaaaa tcagggtatt gttatcacct       300
     aataccgatg aggctaaaaa attctctgaa ctcatcaata cgttttgtga agtattagcc       360
     atccatttga ggcaaaaaag tactcgggat gattttaaaa aatttttaaa aatggtgagt       420
     cttcccagtc atgtgccgtc ttatgttgca caagaactgt attgcgagct ttctgagaag       480
     accaaagcat cgaaaagatt gaatctatgg ttattggata acgaatttag caaatttatg       540
     gatatttgcg gcggttgtga acgtattaaa aatacattta tctcgctttc atttcgggtt       600
     tttgtaaagc atgtattcat tatttttatc ctttttttac cttgcagcct aatcgatacg       660
     cttggagttt gggcaatacc tgctaccatt attatcacct atttaatcat cgccatagag       720
     ggaattgctc gcaatttaga agaaccattc ggtttaacag aagatcactt aaaccttggt       780
     gcaataacag aaagtattag agaaagcgtc aatgaagtct tgctagggca gaaatctaat       840
     gaagaatcca attcaattta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page