(data stored in ACNUC7421 zone)

EMBL: CP000675.PE452

CP000675.PE452       Location/Qualifiers
FT   CDS_pept        complement(488685..488966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56851"
FT                   /protein_id="ABQ56851.1"
FT                   /translation="MKNKLAMSILLFLLPTAAAMANCDLTKFRWDCDLPVQVKPSPGAS
FT                   SLVYCGSSYGYITKQQYDILARYQRASVNMVLDINGEYIDSPCIGAER"
     atgaaaaata aattggcaat gagtatatta ttattcctgt taccaacagc tgcagccatg        60
     gctaattgtg atttaaccaa gtttcgatgg gattgtgatc ttccagtaca ggttaaaccc       120
     agtccaggcg cttcctctct agtgtattgt ggaagctctt acggctatat cacaaagcag       180
     caatatgata ttctggctcg ctatcaacgc gccagtgtca atatggtttt ggatatcaat       240
     ggtgaataca ttgatagccc gtgtatagga gccgagcgtt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page