(data stored in ACNUC7421 zone)

EMBL: CP000675.PE453

CP000675.PE453       Location/Qualifiers
FT   CDS_pept        489115..489978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2949"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2949"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56850"
FT                   /protein_id="ABQ56850.1"
FT                   /translation="MLSSTKEYLQALRDGKYLLFLQWPKFIAEYYGKNDKNQEADEMVS
FT                   LLIFEWLNNGFCLDDIKKFAILYAVHEMESRPLREGLSYALTTISIALFPCMVYLTNNL
FT                   QERYITSKKLSSKEVLQLMTMNNAYLEKQRFVEFLGQEQDKFFTWVKEADSSAVSKAFD
FT                   QIYSVTYLKYLIEDYLNLLESAHLPNDQLKSSRISLVIRLAKYLNEQTELTQDVHDEIA
FT                   VYVKKLWEMQPAEFEEEFLKKISPLPFIDNTVRILTGLSARFFSILQPPSPPLNINSDA
FT                   DKNPKV"
     atgctttcat caacaaagga atatcttcaa gctttacgtg atggaaaata ccttctattt        60
     ctgcagtggc caaaatttat tgcagaatat tatggtaaga acgacaaaaa tcaagaagct       120
     gatgaaatgg tgagcttgct catatttgaa tggttaaata atggcttttg tttggatgac       180
     attaaaaaat ttgctatttt gtatgccgtt catgaaatgg agtccaggcc tttaagagaa       240
     ggattatcct atgcactcac tacaatttct atcgctcttt ttccctgtat ggtgtattta       300
     acaaataacc tgcaagagcg ctatattact tcaaaaaaac tatcaagtaa ggaagtgctc       360
     caattaatga ctatgaacaa tgcttatctt gagaagcaac ggtttgtcga atttttaggg       420
     caagagcaag ataaattttt tacttgggtt aaggaagcag actcttctgc ggtttctaaa       480
     gcgtttgatc aaatttattc tgtaacctat ctgaaatatc taattgaaga ttatcttaat       540
     ttgctagagt ctgcacactt gccaaatgat caattaaaat cttctcgcat cagcttggtt       600
     attcgattag ccaagtatct caatgagcaa acagaattaa ctcaagatgt ccatgatgaa       660
     atagctgtgt atgtaaaaaa gctttgggaa atgcagcccg ctgagttcga agaggaattt       720
     ttaaagaaaa tttcgccact gccgtttatc gataatacgg tacgaatatt aacgggatta       780
     agtgccagat tttttagtat attacaacct ccttccccac ctttgaatat caattctgat       840
     gcggataaga atcccaaagt ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page