(data stored in ACNUC7421 zone)

EMBL: CP000675.PE454

CP000675.PE454       Location/Qualifiers
FT   CDS_pept        complement(490079..490546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2948"
FT                   /product="methylated DNA protein cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2948"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56849"
FT                   /protein_id="ABQ56849.1"
FT                   /translation="MNGKMLLVSIFNTPVGNLEVTHDEHFIFNASFTDKSGTPAQNQLS
FT                   HLIASELKAYFDDPHHRFQLPLKPQGSLFQQKVWNTLLVIPVGRTVTYGELATKLQSSP
FT                   RAVGQACKRNPLALFVPCHRVVGKHDLGGYMGNPNAISYKKNLLAHEAKII"
     ttgaatggta aaatgctcct cgtgtctatt tttaatactc ctgtgggtaa cctggaagta        60
     acccatgatg agcattttat tttcaatgcg tccttcacag acaaatcggg cactccagcc       120
     caaaaccaat tgtcccattt aattgccagt gaattgaagg cttacttcga cgatccccat       180
     caccgttttc agctccctct gaaacctcag ggaagcctct tccagcaaaa ggtttggaat       240
     acgttgttag tgattcccgt tggcagaaca gttacctatg gagaacttgc tacaaaactg       300
     caaagtagtc caagagcagt tggacaagcc tgtaaacgca acccactggc tttatttgtt       360
     ccctgtcata gagtagtagg gaagcatgat ctgggaggat atatgggaaa tccaaacgcc       420
     atttcttata aaaaaaatct gctcgcgcat gaagcaaaaa tcatctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page