(data stored in ACNUC7421 zone)

EMBL: CP000675.PE46

CP000675.PE46        Location/Qualifiers
FT   CDS_pept        complement(52611..52847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54046"
FT                   /protein_id="ABQ54046.1"
FT                   /translation="MKRVHHHPATHSHPSNATVQVSNGQQTVVVNPNPPYFPGQPPMYH
FT                   PNSFFTTHHHSPYYASQNQHYHQQPAPNTHQHP"
     atgaaacgag tacatcatca ccctgcaaca cactctcacc catcaaatgc tactgttcaa        60
     gtcagcaatg gacaacagac tgtggttgtt aatccgaacc ctccttattt tccaggccaa       120
     ccgcccatgt accatcccaa tagttttttt acaacgcatc atcactcacc ctattacgca       180
     tctcagaatc agcattatca ccaacaacca gcgcccaata ctcatcaaca cccataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page