(data stored in ACNUC7421 zone)

EMBL: CP000675.PE461

CP000675.PE461       Location/Qualifiers
FT   CDS_pept        495128..496636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2941"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56842"
FT                   /protein_id="ABQ56842.1"
FT                   /translation="MIYVLICIMLVCGLVVYQLMPKLLSYSTSLISKKQDTSELTHDGI
FT                   TNVLTQLGHPKFEGVCYGFTLNWALAVAQGKESFFYRQLHHLRTHQFGLPKTLQQIKEK
FT                   KERNQSLSNDEMVIDTLPQLGKKICVAQDPLQYKEKYRKLVWQPDINSILKAINADSSV
FT                   AKHIFYKTHSFLNQDEATEYLELLKRTGIREDVAVIISTADHAMGFKLAGNVWRFININ
FT                   DLYQQDKNKPYFEFSSRNLVKELYRVCAENLQGSRLTVNTDFVSVNPEEKLSRALQNVF
FT                   PVFPVRTKTSYPERLAFFSMAATQGDMNSVKKCIHSGWSIFSRQRLSDDSPILTAIYLG
FT                   RRDVVRAMLSTSRHRVNQKRKSDSSTLLHIACRYGGSGIVEDLLNIRGIKIDPQDNKGR
FT                   TPLMYACKKSVVTEDKKLFNLLFAKGASLSIKDNDGLTALDHALKNEHTLAIQMIEERL
FT                   EKEACAKENSTSRRFKFSETKGTLFQRGVKTISYQSQQPGFGMK"
     atgatttatg ttttaatttg tattatgcta gtttgcggtt tggtcgtgta tcaactcatg        60
     cccaagcttc tttcgtattc tacttccttg atctccaaaa aacaggacac cagtgaatta       120
     acacatgatg gtattacgaa tgtcttaaca caattaggtc accccaagtt tgaaggagtc       180
     tgttatggct tcactctcaa ttgggcattg gcagtggctc agggtaaaga atcctttttt       240
     taccgccaat tgcatcattt gcgaacccac cagtttggtt tgcctaaaac attacaacaa       300
     attaaagaaa agaaagaaag gaaccaatca ttaagcaacg atgagatggt tattgacact       360
     ttgcctcagt taggaaagaa aatttgtgtt gctcaagacc cattgcaata taaagagaaa       420
     tacagaaaac tggtatggca gcctgatatt aattccattt tgaaagccat aaatgccgat       480
     tcttccgttg caaaacacat tttttataag acgcatagtt ttttaaacca ggatgaagca       540
     acagagtatc ttgaattatt aaaaagaaca ggcatcagag aggatgttgc agtaattatc       600
     agtaccgcag atcacgccat gggatttaaa ctggctggta atgtctggcg atttattaac       660
     atcaatgatt tataccaaca agacaaaaat aaaccttact ttgagttctc gtcccgaaac       720
     ctggttaaag agttgtatcg tgtttgtgcc gaaaatcttc agggaagtcg attgaccgtg       780
     aataccgatt ttgtttcagt taatcctgaa gaaaaactgt caagagcact gcagaatgta       840
     ttccctgtgt ttccagtcag aaccaaaact tcttaccctg aacgattggc ttttttttcc       900
     atggcagcta ctcagggtga tatgaattct gtaaaaaaat gcattcattc tggctggtca       960
     attttttctc gacaacggct aagtgatgat tcgcctatcc ttaccgccat ctatttggga      1020
     agaagagatg tagtacgtgc catgctgagt acttctcgac atagagttaa ccaaaagcgt      1080
     aaaagcgatt cttctacttt gctccatatt gcctgtcggt atggtggtag tggtatagtc      1140
     gaagatctgt tgaacatacg tggaattaaa attgatcccc aagacaacaa ggggagaacg      1200
     ccgctcatgt acgcctgtaa aaaatctgta gtgacggagg ataaaaaatt atttaatttg      1260
     ttatttgcaa aaggcgcttc tctttctatt aaagataatg acggtttgac cgcacttgat      1320
     catgctctta aaaacgagca tacccttgca atccaaatga tcgaggagag attggaaaaa      1380
     gaagcttgtg cgaaggagaa ctcaacctct cgtcgattta aattttctga gacaaaaggt      1440
     actttgttcc aaagaggagt gaaaactatt tcttatcaat cacagcaacc tggttttggt      1500
     atgaaatag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page