(data stored in ACNUC7421 zone)

EMBL: CP000675.PE467

CP000675.PE467       Location/Qualifiers
FT   CDS_pept        complement(501142..501345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56836"
FT                   /protein_id="ABQ56836.1"
FT                   /translation="MFTKIFIIFVMILIVASLASGLFYLVKDTDKSKRTVKALTVRIAI
FT                   SLSLFVFLFIAFKLGLIQPHGI"
     atgttcacta aaatcttcat catctttgtc atgattctta ttgtggcctc attagcgagc        60
     gggctctttt acctggtcaa agacactgat aaatcaaagc gcacagtcaa agcgctcacc       120
     gtgcgcattg caatttcatt atctttattt gtgtttttat ttattgcctt caaattggga       180
     ttgattcagc cacatggaat ttag                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page