(data stored in ACNUC7421 zone)

EMBL: CP000675.PE468

CP000675.PE468       Location/Qualifiers
FT   CDS_pept        501413..502141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2934"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3346"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2934"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56835"
FT                   /protein_id="ABQ56835.1"
FT                   /translation="MPSLTCFNFRFTSNWPMLILTAVCFFLFISLGFWQIHRADEKTEM
FT                   ITAQQALAKKEPIIWQPGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPML
FT                   LDDGSIVMVDRGWVSGDITRRTFPNVQTPNGKFKLFGMVYFPSKKQWILGPSFEEKENK
FT                   VTLLELIDEEILKQLLQKKVYPFIIRLDKNEPFGFVREWEIVSMPPQRHFAYAIQWFAM
FT                   ALVILIIFVIFNLKKNEKTI"
     atgcctagtt taacctgttt taattttcgt ttcacctcaa attggccaat gcttattctt        60
     acggccgttt gctttttttt attcattagc cttggatttt ggcaaataca cagagccgat       120
     gaaaaaactg aaatgataac cgcacaacaa gcgctggcaa agaaggagcc cataatttgg       180
     cagccagggc aaaaattgcc agagcaatat caacgaatca gcattgaagg agcttttctg       240
     ccaaagttat ttttgcttga taatcaacat tatcaacatc agtttggtta tgacgtggtt       300
     tctcctatgc ttcttgatga tggctccatc gttatggtgg atagaggatg ggtttctgga       360
     gacattactc gacgcacttt tcctaatgtt cagactccca acggcaaatt taaattattt       420
     ggcatggttt attttccaag taaaaaacaa tggatattag ggccaagttt tgaagaaaaa       480
     gagaataagg tgactcttct tgagctcatt gatgaagaaa tactgaaaca acttttgcaa       540
     aaaaaggtct atccgtttat tattcgcctc gacaagaatg agccttttgg ttttgtacgt       600
     gaatgggaga tagtatccat gcccccgcaa aggcactttg cttatgcaat acagtggttt       660
     gccatggcat tggttattct gattatattc gtgattttta atttgaagaa aaatgaaaaa       720
     accatataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page