(data stored in ACNUC7421 zone)

EMBL: CP000675.PE470

CP000675.PE470       Location/Qualifiers
FT   CDS_pept        502675..503682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2932"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56833"
FT                   /protein_id="ABQ56833.1"
FT                   /translation="MSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCPDWPGCYGR
FT                   MVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQVWFKRRQDQ
FT                   DLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRFRLQIAQLK
FT                   GQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGTWFPELHFAKGFNL
FT                   FSTIGANYQGGVLESEVRASIQFIHRIGAILTATYLLALSLIIVFKTHSIYLRATAVIM
FT                   AMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDREVSHAY"
     atgtctaata gttcaatacg attagcagca actcttgctg tttttttggc tttttttgtc        60
     gttatgttag gcgcttatac tcgtttaact gatgcgggct taggctgccc ggattggcca       120
     ggttgttatg gtcgcatggt tcttccagga gcagataaag gtttgcaaga agctcaatca       180
     caatatccgg accttcctat tgaatccaag aaagcctgga ccgaaatggc tcatcgctat       240
     gcggcaggaa cgttagccct gttgattttt ttcattgctt tccaggtatg gttcaaacgt       300
     cgtcaggatc aagatttgcc ttggcatctt cccttggctt tatttatgct tgtggtattt       360
     caggcggcat tgggaatgtg gactgttact ttaaaattac tgcctgtagt tgtcatggga       420
     catttgctgg gaggcatgtt aatcgttgcc tgtttatgcc gttttcgttt gcagatagcc       480
     cagctaaagg gtcaaaattt acctgaatgg cgaccgtggt tgcgtttggg aattgttatc       540
     attttgttgc aaattgcttt gggtggttgg gtaagtgcca attatgcagg tatttcgtgt       600
     attggttttc cattatgtaa cggaacctgg tttcctgaat tgcattttgc aaaaggattt       660
     aatttatttt ctacgatagg cgccaattac caaggcggtg ttctcgagag tgaagttcgg       720
     gccagcattc aatttattca tagaataggg gctatattga ctgccactta tctactggct       780
     ctgtcattaa taatcgtatt caaaacgcat tcaatttatt taagagcaac tgctgttatc       840
     atggctatgt tagtattact tcaattcact ttagggataa tgaatgtgat tcatctatta       900
     ccgctcaagg ttgcggtcgc tcataatggt gtagccgcat tattattagc ggtggcattt       960
     tgttctttgc attttacaca agatagggag gttagccatg cgtactga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page