(data stored in ACNUC7421 zone)

EMBL: CP000675.PE48

CP000675.PE48        Location/Qualifiers
FT   CDS_pept        53472..53870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54048"
FT                   /protein_id="ABQ54048.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKTLSVFPAGTSINKTTVKEICFTDI
FT                   FCDTHPFVWYYYPEHNLAIWTSRLAGTTQEYPVDYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQDHQMIPIRNSESWRYIKSSSFSMS"
     atgaactgtt ttcctttctt tgcaaaaaaa aataaaaaaa ataacgaaga aaaagcggaa        60
     aaaacattaa gcgtatttcc tgcaggtact tctataaata aaacaacggt aaaggaaatt       120
     tgttttacag atatcttttg tgacacccat ccttttgttt ggtattacta tccagaacat       180
     aatctggcaa tttggacttc aagactggca gggacaaccc aagaatatcc ggtagattat       240
     ttgcttaatc aacttgcaaa aattcctgga attaccatcg accaaggtga tgcagccatc       300
     aaggatgtta gtactttcct ccaggatcat caaatgattc ctattagaaa cagcgaaagc       360
     tggcgatata tcaagtcttc ttctttctca atgagttaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page