(data stored in ACNUC7421 zone)

EMBL: CP000675.PE486

CP000675.PE486       Location/Qualifiers
FT   CDS_pept        518360..518791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2916"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase,
FT                   histidine triad family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56817"
FT                   /protein_id="ABQ56817.1"
FT                   /translation="MFCIDDRIKSSSFILGEWPLSTVLLKNDASYPWFILVPRKMDIQE
FT                   IYQLEKSERFLLIEEINQLSLLVRDYFKPDKLNIGALGNIVPQLHIHIVIRSKNDPLWP
FT                   QGIWQSSMPSIPYPESELKSLLPTLGDLVRAYDKPQSLC"
     ttgttttgca ttgatgatcg gattaagtcg tcttctttta tacttggaga gtggccttta        60
     tctacggttc ttttaaaaaa tgacgcctca tacccctggt ttattttggt tccaagaaaa       120
     atggatattc aagaaattta tcagcttgaa aagagcgagc gatttttatt aattgaagaa       180
     atcaatcaac tgtctcttct ggtgagagat tattttaaac cagacaagct taatataggc       240
     gctcttggca atattgttcc gcaattgcat atacatattg ttattcgcag caaaaatgat       300
     cctttgtggc ctcaaggtat ttggcaatct tccatgcctt ctattcctta tcctgaaagt       360
     gaactaaaga gtctgctgcc taccttgggt gatttagtca gggcttacga taaaccccaa       420
     tctctttgtt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page