(data stored in ACNUC7421 zone)

EMBL: CP000675.PE487

CP000675.PE487       Location/Qualifiers
FT   CDS_pept        complement(519005..519433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2915"
FT                   /product="glyoxylase domain hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56816"
FT                   /protein_id="ABQ56816.1"
FT                   /translation="MFIIVIYNSSNGESIFKFQQGALMIKKIAFTMYPVQNMDRARQFY
FT                   EKTLGIKVGKISAEGAWVEYDLPQGGCFAITTLAQGVIPSANSGGSVAFEVDNLDELVF
FT                   QLKSKGVQFKIDLFASPVCRMAIAVDSEGNAFTLHQLT"
     atgtttatca ttgtaattta taattcatct aatggtgaaa gtatatttaa atttcaacaa        60
     ggagctctca tgatcaaaaa aatagcattt accatgtatc cagttcaaaa tatggataga       120
     gcaaggcaat tttatgaaaa aacacttgga attaaagtcg gtaaaatttc cgctgaggga       180
     gcatgggtag aatatgattt acctcaaggg ggttgttttg caattactac attggctcaa       240
     ggagttatcc ccagcgctaa ttccggaggt agcgttgctt ttgaagtaga taatcttgat       300
     gagctggtat tccaactaaa atccaaagga gttcagttca aaattgacct attcgcttca       360
     cctgtttgca gaatggcgat tgctgtggat tcagagggaa atgcgttcac tttgcatcaa       420
     ttaacatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page