(data stored in ACNUC7421 zone)

EMBL: CP000675.PE490

CP000675.PE490       Location/Qualifiers
FT   CDS_pept        521958..522890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2912"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56813"
FT                   /protein_id="ABQ56813.1"
FT                   /translation="MSMSKFIEWIDKVDPYAVQRIALYKSLFIATVMAYVYWVFRPTNF
FT                   TAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSIIA
FT                   LASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFICL
FT                   RFFPNQYLSVWKRALAKFIQSLEQDIEGSFSHRGPRFMQEEMTHLGMLRQYRRLIPKKY
FT                   MIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYTLRCAIKTNTSCDTPKMSIV
FT                   PESKLQQYVMRCLQQAFSHWNRLCMILQH"
     atgtctatgt cgaagtttat tgaatggatt gataaggttg atccttatgc tgttcaacga        60
     atagcgctct ataaatcact ttttattgcc accgtaatgg cctatgttta ttgggtattt       120
     cgtcccacga attttacggc atttttttca ccatttttgc tcgtaagatt ttatgaatca       180
     cccagtctta ccagctttaa agagaaagaa cactttttga tttttattgg agtggtagtg       240
     gtattgttga gtacctcatt ttatcttgtt tacccatttc gggttgtatt tttctttttc       300
     tcaattattg ccttagcaag cgtttatttt tatgtgctaa aaaattatct tccattaagg       360
     aatgttacta tgctcattat tgcttccgga gcgacaattt taagtacaga acctcctgca       420
     aattggcaaa ttgtctacga catcgttggg tcaagcgctt tatctatgat cgccatattc       480
     atttgtttaa gattcttccc caatcaatat ctcagtgtat ggaagagggc tttggcaaaa       540
     ttcattcaat cccttgaaca ggatattgaa ggatctttta gccaccgcgg ccccagattt       600
     atgcaggaag aaatgactca tttgggtatg cttaggcaat atcgtaggct tatccccaaa       660
     aaatacatga tttatactca gcgaatttca atcaacatac gcaacattca attttctttg       720
     gataatcttt attatgaagc caaaaatgag gctttctggc atggagtgaa agagaatctt       780
     tatactctta gatgtgcgat taaaaccaac acatcctgtg acactcctaa aatgtctatc       840
     gtgcctgagt caaaattaca acaatatgtt atgagatgtt tgcaacaagc atttagccac       900
     tggaatcgat tatgcatgat acttcagcat tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page