(data stored in ACNUC7421 zone)

EMBL: CP000675.PE491

CP000675.PE491       Location/Qualifiers
FT   CDS_pept        522869..523756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2911"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56812"
FT                   /protein_id="ABQ56812.1"
FT                   /translation="MHDTSALKKKLDYARFIHLVIMFMVAMLIFLFSTFPEKWWVLITV
FT                   LSVSAGIEPGLIIRRAKHRIGGTLLALIILIPLLYLLQLNYRLISILFVLAIVGLSVAT
FT                   LNTRRYDISVFFITLVVFFLMAQTEEATSPRGPFEMVLNRGICTLFGVFIVLAGDYFLF
FT                   QAYRYSHRLYFFHQVMVYDFLNDIVRKIDESNTEKINTLLFVEKLRGQFTEHYLPISIS
FT                   SENLKLDFKTSEHTKKRIDIFQETIWEIRRLVFALCISEFVLHSSTASEQHLQRFKLLM
FT                   NKARTHFIQFEGRY"
     atgcatgata cttcagcatt gaagaaaaaa cttgattatg ctcgatttat tcatctagtc        60
     atcatgttca tggttgccat gctcattttt ttattttcga cttttcctga aaaatggtgg       120
     gtattgatca ctgtcttgtc agtaagcgcg ggtattgaac caggattgat tatcagaaga       180
     gctaaacaca ggataggagg gacactgtta gctctcatca ttttgattcc cttactctat       240
     ttattgcaat tgaattatcg attgatatca atcttatttg ttctggcgat agttggtttg       300
     agtgttgcta ccttaaacac aagacgttac gacattagtg tattttttat tactttagtt       360
     gtcttttttt tgatggcgca aacggaagag gctacatcgc ctcgtggtcc ttttgagatg       420
     gttcttaatc gaggcatctg tacactgttt ggtgttttta ttgtgttggc aggcgattat       480
     tttttatttc aggcataccg ttattctcat agactttatt tttttcatca ggtgatggtt       540
     tatgattttt taaatgatat tgtgcgaaaa atagacgaat ccaatacaga aaaaattaat       600
     acattgctct ttgtagagaa attacgtggt caatttaccg agcattatct cccgatatcc       660
     atcagctccg aaaatttgaa actggatttt aaaacaagtg aacatactaa aaaaagaatt       720
     gatatttttc aagaaacgat ttgggaaata cgacgcttgg tttttgcatt atgtatttca       780
     gagtttgttt tacattcctc aacggcatct gaacagcatt tacaacgatt taagttactg       840
     atgaataaag ctcgaaccca ttttattcag tttgaaggtc gttattaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page