(data stored in ACNUC7421 zone)

EMBL: CP000675.PE492

CP000675.PE492       Location/Qualifiers
FT   CDS_pept        523778..524158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2910"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56811"
FT                   /protein_id="ABQ56811.1"
FT                   /translation="MPHPDYSVYNEKCPSHNVLEGISDKWSILVISLLSQKIYRFGELK
FT                   REIGGISPKMLTQTLLKLERYGFVQRQSYPVLPMKVEYSLTRLGKELSAILVLLTRWTE
FT                   TNMDKIIKAEKTFCEQKLGCQA"
     atgcctcatc ctgattatag tgtttataac gagaagtgcc catcgcataa tgtgcttgaa        60
     ggtattagtg ataaatggtc tatattggtt attagccttt tatcccaaaa aatataccgt       120
     tttggagagt taaaacgtga aatcggtgga atatcaccta aaatgttgac gcaaacatta       180
     ctgaaattgg agcgatatgg ctttgtccaa agacaatctt atcctgtttt acctatgaag       240
     gttgagtatt cattaaccag attgggtaag gaattaagtg ccatattggt tttacttact       300
     cgttggactg aaaccaatat ggataaaata atcaaagcgg aaaaaacatt ttgcgaacag       360
     aagcttggtt gtcaagcctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page