(data stored in ACNUC7421 zone)

EMBL: CP000675.PE496

CP000675.PE496       Location/Qualifiers
FT   CDS_pept        complement(525619..526419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2906"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56807"
FT                   /protein_id="ABQ56807.1"
FT                   /translation="MGRSEMKIASAKLRELMKAVSEGHYETVNTILDKDPELVNQYVPP
FT                   TYDSPLARVLNKKYIDYKMLDILVKHHVDFDYPINHHKETPIELACKNQDLQLFKYLVQ
FT                   HNAPISEHAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCNAEGNRFEELA
FT                   RKSQLINRFGGVVRYDYMQLLQSVYPIVDREVDTPTINASTEKLTNLLNKIRDQHISKE
FT                   GYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNTL"
     atgggtagaa gtgaaatgaa aatagcatca gctaaattgc gtgaattgat gaaggcagta        60
     tctgaaggtc attatgaaac tgtcaataca atactggata aagatcctga gcttgtaaat       120
     cagtacgtcc cccccactta cgattcaccc ctggcaagag tattaaataa aaaatacatt       180
     gactacaaaa tgcttgatat tttggttaag caccatgttg attttgatta tcccatcaac       240
     catcacaaag aaacaccaat tgaattggct tgtaaaaatc aggatcttca attattcaaa       300
     tacttagtgc aacacaacgc ccccatttca gagcatgcac cacatttcct gctggtgaat       360
     agcaccaata tcaaatacct gacagaagat aaaattaaaa atacctgtga aattattaaa       420
     ttaatgggtg gtttggaagc cgtctcttct aaatgtaatg cggaaggtaa tcgcttcgag       480
     gaactggcaa ggaaatcaca attaatcaat cgtttcggtg gtgtagtaag gtacgattac       540
     atgcaattgc tgcaatcggt ttatccaatt gttgatagag aagtggatac tccaaccatt       600
     aatgcctcta ctgaaaaact tacaaacctg ctcaataaaa ttagggatca gcacatctca       660
     aaagaaggat acgatcaaca aaatttaaaa gattctatca gccttttctt tatgaccggt       720
     ggagaaatac ctccttcaag aaaagttcca gagagtcgtt ttgaagaagc tggcatagac       780
     acccctaaaa acacgcttta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page