(data stored in ACNUC7421 zone)

EMBL: CP000675.PE497

CP000675.PE497       Location/Qualifiers
FT   CDS_pept        526690..528690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56806"
FT                   /protein_id="ABQ56806.1"
FT                   /translation="MQNLDEILKKLGEDLKKTSKETANKLSVLSRKVAEDVVKVSDETV
FT                   QKINEVTKKLSVDTTVSTIDTQRILDDFMKNIRFSRFKQIWQAIEETPKSKHILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKELLPLLIANADTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQKTNINLSKYLSLVGDKTDISEFLILTIGLFTSLKIGDKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEEKIQKIMKAVESLQIFNPTSNDPRRF
FT                   FETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAEAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMENYKEDPDLPNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
     atgcaaaact tagatgagat tctaaagaaa ctgggagaag atctgaaaaa gacttcgaag        60
     gaaacagcta ataagctaag tgttttatca aggaaagtcg ctgaagatgt ggttaaggta       120
     tccgatgaaa cggttcaaaa aattaacgaa gtaaccaaaa aactctccgt agatactaca       180
     gtcagcacta ttgacaccca aagaatttta gatgatttta tgaaaaatat acgcttttct       240
     cgatttaagc agatttggca agcaattgag gaaacaccga aatctaagca tatattgtta       300
     aaatctcttt tcttaaaagg gctattgact cataataaac ctctacttga agaaattata       360
     cgacaaattg aattaatacc ttactcaagt gatctggaga tgctcggtgc ttttagtcag       420
     gacaaagcac atccgctctc acctgagctt ctggagtttg tgcaagagat gcttgccaat       480
     gaaagtgaga aagtattgct cactattctg atgaatgctt tccagtctat ccctgagctg       540
     tctcttgata gcaagacagg gactttaagc atgaaaacta aaaaagagtt actgcctctt       600
     ttaattgcaa acgcggatac ttcgattgca aaatcaatca tgtcacaatt aactgatatc       660
     tcatttgatt ctgtattacc cgcatttcgt ccatcgattg gtgatcccag ctatcagaaa       720
     acgaacataa acttgagcaa atacttgtct cttgttggtg acaaaacaga tatttcagag       780
     tttttaatat taacgattgg tctttttact tccttaaaaa ttggagataa ggggtttttg       840
     caagaattat cggctgatta tttatttgtt cgatatgatg actgcttgca taaaataata       900
     gaaaaactaa aggaaaaaga agtaatagaa caattaggag aagaaaaaat tcaaaaaatt       960
     atgaaagctg tagaaagcct tcagatattt aatcccacga gtaatgaccc aagacgtttt      1020
     tttgaaactc gccttgctca gtacattaac ggtctttccc actcagaaaa gaccattgaa      1080
     attgattcga taggagaaga taaagagcct gaagatgagg aattgagaga taacacattg      1140
     aaggcatgta ataaaattct gcaattcttt ttaggtgatt gtggaagagt ggatactccg      1200
     cgggagatgg aacaaaaaat ttgtatcttt gccaatggct ataaggatac ctctaaattt      1260
     accaagaaag aagttgaatt tattaccggt gtattacatc acgctgaagc gcataaaggg      1320
     cgcgataggg ttgagcggga taaattgacg ggcattaaag aaagaaaatt tgagactgac      1380
     tcagaaaaag taggttcaga tgtatggaat tgtggcggtg gagtcatgaa aggctgttcg      1440
     cctgtctttt atgatgccca acgcgacccc atgcgtaata tgctagtgga ttcttcaact      1500
     gttgctcctg ataacaaaga gggaaaacaa tggttttgga ataataaccg tcagtattcg      1560
     tcttacgtag gatcgatttc cggacatact tgcaatattg tgggtatgtt agccaagtat      1620
     atggaaaatt ataaggaaga tcccgatctg ccaaacgata tcaatctttt tcttattcag      1680
     gtcataggtg tttatgccaa gcgcggtttt catgccatgc ttgaggtcat tgatgttctt      1740
     catgatcctt atgtacaaga catattcaaa ggatatggtg ttcaagttaa cctttatagc      1800
     tattttaaag aaaaccctga gcttgctgga ttcctgcagc atgcgatgaa tgatgcaacc      1860
     acgtatactc aggctcttgt taataagaag catgttaagg aagcactcaa atcaaattca      1920
     ttcttcagca agaaagacga agagagtgga gataagaaaa atgaccatac gccaaaagat      1980
     ggaactgttt atgggtgcta a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page