(data stored in ACNUC7421 zone)

EMBL: CP000675.PE512

CP000675.PE512       Location/Qualifiers
FT   CDS_pept        543422..543763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56791"
FT                   /protein_id="ABQ56791.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSMKEPVMYLMVGALLIYFPSLVSSVLPNDFWLLAI
FT                   PLAYSRKFE"
     atggctgatc cgacttgtac tggcggcaca gtagcatgct ggatagtgag tcaagctaac        60
     atattagcta atatagctaa tcagttggaa cctgttcaaa ggctgattac tggaggcgct       120
     tatttgattg ggtgtgcttt tatatttaaa gcaatttata gtttaaaggt ttatggagaa       180
     gccaggacaa tgatgtcgag caatacgagt atgaaagagc cggtgatgta tttgatggta       240
     ggtgcattac ttatctattt cccatcattg gtttcttccg tactgccaaa cgacttttgg       300
     ttattagcaa ttccgctggc ttactccagg aagtttgagt ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page