(data stored in ACNUC7421 zone)

EMBL: CP000675.PE53

CP000675.PE53        Location/Qualifiers
FT   CDS_pept        57022..57132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54053"
FT                   /protein_id="ABQ54053.1"
FT                   /translation="MRLGLILQLLSLAFIDNCFDGGFFVPLKGKLRGYQT"
     gtgagattag ggttaatttt acagttgctg tctttggctt ttattgataa ttgttttgat        60
     ggcggttttt ttgttccatt gaagggaaaa ctaaggggtt atcaaacttg a                111
//

If you have problems or comments...

PBIL Back to PBIL home page