(data stored in ACNUC7421 zone)

EMBL: CP000675.PE531

CP000675.PE531       Location/Qualifiers
FT   CDS_pept        complement(567658..567942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2871"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56772"
FT                   /protein_id="ABQ56772.1"
FT                   /translation="MSNRKNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKNSRIYYS
FT                   PLLQPSVNSEGYKCVLLDPKLKESSPQVYQAIMDFAKANNLKICGEEDL"
     atgtctaatc gaaaaaataa aactattgtc attgagggtg ttacttcaca aggcaaaaca        60
     tttcgcccaa gtgactgggc cgagcgtatg agcggttctt tagctgtttt taaaaatagt       120
     agaatttatt attctccgct cttgcaacca agtgttaata gtgagggtta taaatgtgtt       180
     ttacttgatc ccaaactcaa ggaatcaagc ccacaagttt atcaggcaat tatggatttt       240
     gctaaagcta acaacttgaa aatctgtggt gaagaagact tataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page