(data stored in ACNUC7421 zone)

EMBL: CP000675.PE538

CP000675.PE538       Location/Qualifiers
FT   CDS_pept        572056..572217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2864"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56765"
FT                   /protein_id="ABQ56765.1"
FT                   /translation="MKYKSGFITKKPKYCNIFTLFSLKTDFSGLLSKQVSGKSRIFNQN
FT                   QYNPEILY"
     atgaaataca agagcggttt tataacaaaa aaacccaaat attgcaatat ttttactttg        60
     ttttcattaa aaactgattt ttcagggctg ttgtccaaac aggtatctgg taaaagtaga       120
     atatttaatc aaaatcagta taatcctgaa attttatatt ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page