(data stored in ACNUC7421 zone)

EMBL: CP000675.PE541

CP000675.PE541       Location/Qualifiers
FT   CDS_pept        574118..575605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56762"
FT                   /protein_id="ABQ56762.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKLEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVAGKISLALHL
FT                   LGVDENNFTPGESEKTDVLSILSKVKKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   AKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLASMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKAEALRGIAMLICRGAEPPRNEKMRNLLSSNRVAFLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQNSPRVVLK"
     atggattttg taagtgaaat gaataagatt ctacaaatgg aattagagca atttaaagaa        60
     tttattcaaa agaagctgga agaagataaa aattatttag aaaagttatt ttggttgccg       120
     aatggttctc aaatgactgt tttaaattat ttgatcgaac aatactctga gcctaagctt       180
     ggtatagacg atgcaaatag ggatttgctt gccaaaatag attttgtcct tcacgaggct       240
     aaagatgtga atgttggtga gcctttgcac caggcaattg ttgctggaaa aatttccttg       300
     gcactccatc tgctgggagt ggatgaaaat aatttcacac ccggggagag tgaaaaaacg       360
     gatgttttga gtattttgtc taaagtaaag aaaaaaatcg aagagtcttt taatcacgta       420
     aaaagatgtt tttttgatgt ggataaacgg gatggttatg ggcgcacttt gttgtctttg       480
     gcattagatg ccaaacgcca ggaactgtta attgccattt tagcaaggaa tcccattgta       540
     cacgcaacaa cgttaagatc ctcagcctat gttcctttcc agcctattca tcaggctgtt       600
     gttttagatt atgcagaggg cattacctta ttagccagca tgggggcgca attgacaaat       660
     cccctgggta gtatgagaga cactccggtc attttggctg ctcgtttggg gaaaataaat       720
     gcactggcgg ctttactgga gttacccact caaagtttgt ctcttgaatc cgaaaacaat       780
     catttattcg aagacaaaca aactggccat acagcagtgg aagagttatg tgaacgcatg       840
     gccaatgaga atgataaagc agaggctctt cgtgggattg ccatgctaat atgccgtggt       900
     gctgaaccac ctcgcaatga aaaaatgcga aatttattaa gcagcaaccg ggttgctttc       960
     ttaaaagcgg tcagtaccta tttggcagat aagcctcaat tggtcgatgc ttttgtagag      1020
     cgttgtcatc tacgagaaag tgctttgcat aatatagttt atgccgatca ttcatggggg      1080
     agttctattc gtcatttact cggtgttccc agtgaggcgg cccttattgt tgaagaatta      1140
     gtaacgagaa aatacagtga tccttccttt gccagcgaaa atgtttcgtc attatcaact      1200
     actgctacgg aaaatctacg ttcagagagg aacccactga aactctatgc cgaatttgtc      1260
     aggcgataca cgcaagcata tgatagccaa atgattacca atcgttggag taccatgcgc      1320
     tggatgatcg ccgaagggaa ttgtgattgg gatacagtag ttcggtattc gaaaaatcat      1380
     ccaacgagcc gtaccaggat tgtgttgaat gaaatgttta acccgatacc gagggtacat      1440
     gaggatattg agtctcaaca gaattctcca agagttgtcc taaaataa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page