(data stored in ACNUC7421 zone)

EMBL: CP000675.PE55

CP000675.PE55        Location/Qualifiers
FT   CDS_pept        complement(57598..58080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54055"
FT                   /protein_id="ABQ54055.1"
FT                   /translation="MWLDYLHKINSDPNLLYLFIRTFIIYVFAIFIIRVGNTRYNFETA
FT                   FDYIFVFVIGAVLSRAINGNSTLISAMAGSSLLIFLHWVFAICSFYSHGFGKLVKGKSV
FT                   LLIQDGQLIWSALKRHQVTEEDLRQVFREKLNASDLTTVKEARLERTGRISFITYK"
     atgtggcttg actacctcca taagattaat tccgatccaa accttttata tctttttata        60
     agaactttta ttatctatgt tttcgcaatt tttatcatcc gtgttggcaa tacccgatac       120
     aattttgaaa cagcatttga ttatattttt gtatttgtca ttggcgccgt gctaagtcgt       180
     gcaattaatg gcaactcaac tttaatatct gcaatggctg ggagcagttt acttattttt       240
     ttacattggg tctttgctat ttgctccttt tattcccacg gatttggaaa actggttaaa       300
     gggaaatcgg tgctattaat acaagatgga cagctcattt ggagtgcttt gaaaagacat       360
     caagtgactg aagaagattt gaggcaagtt ttcagagaaa aattaaatgc aagcgatttg       420
     acaacagtga aagaagctcg tttggagcga acggggcgta tcagttttat tacctacaaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page