(data stored in ACNUC7421 zone)

EMBL: CP000675.PE554

CP000675.PE554       Location/Qualifiers
FT   CDS_pept        588212..589327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2848"
FT                   /product="leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56749"
FT                   /protein_id="ABQ56749.1"
FT                   /translation="MPYFYTRSAPLFFVFVIALIFINFSYAHEFQTDSKNKHKVDVHIG
FT                   IYAPFSSHSAFIGRNILAAMEMGSERIQSSDIHYSFYTLDQLPKNKNAGLVLQKFIDTH
FT                   HINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTEVADGRNNFIVWSPAYDQAKVLVNE
FT                   LKRQQVHHLGIITANQPSSTALTHSVIKQLQADSHIDVAASEYFEPGNKDFSRLANRIK
FT                   RKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERATPEVVKVFEGQWYVDSHEMQ
FT                   PDFINEFKKNYLNYPVTEAGYAFDLFQLLNKSIVMAIKTQGSPTSQEVVHQLHDIANGT
FT                   GVMGTMVLDSKGSLFTKSEVKTVKNGEIHTV"
     atgccctatt tctatacaag atcagcgcct ttgttttttg tattcgttat cgcacttatt        60
     tttataaatt tttcctatgc ccatgaattt caaactgatt caaaaaataa acataaagtg       120
     gatgttcaca taggtattta tgctccgttt tccagtcatt cagcttttat tggaagaaat       180
     attctggctg caatggaaat gggcagcgaa cggatacagt cctccgatat tcattattca       240
     ttttatactc tggatcaact tcctaaaaat aagaatgctg gtcttgtgct gcaaaaattt       300
     attgataccc atcatatcaa tgtgttggtg accggaggta aagaaacggg gttaatagca       360
     gctcccatag caaagaaaaa caatttgatt cattttagtc tgaccaacaa tactgaagtt       420
     gcagacggca gaaataattt tatcgtctgg agtccagctt atgaccaagc caaggttttg       480
     gttaacgaac taaaacgtca gcaggtccat cacttgggaa ttattacggc aaatcaaccg       540
     tcctcaaccg ctttgacaca tagtgttata aaacaattgc aggctgattc tcatattgat       600
     gtggctgcct ccgagtattt tgaacctgga aataaggatt tttcaagatt agctaataga       660
     attaaaagaa aaaatgcaga tatgtatttg gtaatggcat cacctgagga tattaaatta       720
     atacaagaac aaatggaggc agataaacag catgtgccca ttaccagtat agttgagcgt       780
     gctactccag aagtggtaaa ggtatttgaa ggtcaatggt atgttgattc tcatgagatg       840
     cagcctgatt ttattaatga atttaaaaaa aattatttaa attatcctgt aactgaggca       900
     ggttatgcgt ttgatttatt tcagcttttg aacaaaagca tagtaatggc gataaaaaca       960
     caaggttctc ctacaagcca ggaagtcgtt catcaactcc atgacattgc caatggaaca      1020
     ggcgtaatgg gaactatggt attggacagt aagggttctt tatttaccaa atctgaagtg      1080
     aaaactgtga aaaatggcga gattcatact gtctag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page