(data stored in ACNUC7421 zone)

EMBL: CP000675.PE563

CP000675.PE563       Location/Qualifiers
FT   CDS_pept        598666..600978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2839"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56740"
FT                   /protein_id="ABQ56740.1"
FT                   /translation="MKKVSNKLILGVCCSTLLAWSSQSFSSDTFIVKGIRVNGLQRVST
FT                   GTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGNVLVVNVIERATIGSIT
FT                   VVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAYTARGKYNSRIETKVTP
FT                   LTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLSTSNLFTYFTKKDQYSK
FT                   PGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIHIEEGPQYHFSGYDVVG
FT                   KTILPKEKIDSLIQVKKGDVFSRKKVTESISAIGLALGDVGYGFPAINAEPRIDENNKT
FT                   VFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLLSLHNIKESERQLRMLG
FT                   YLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNGYQFNASVNQRNFMGSG
FT                   RSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDPKNLNVSTYSSNRYGGD
FT                   ISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNHFQEIRLTSGWSRNSYD
FT                   QMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTRGWIFSVLGNVGYGNTF
FT                   DNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGANFLVNGSVGLILPYPLS
FT                   RDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWRSPFGPLSFSLAKALNP
FT                   QPLDQTQLFQFALSSGF"
     atgaaaaaag tcagtaataa attaatatta ggtgtttgtt gttctactct tttagcttgg        60
     tcatcccaat ccttttcttc tgataccttt attgtcaaag ggattagagt taacgggtta       120
     caaagggttt cgacaggtac ggtattaaac tatatgcctg tgcaagtggg tgaggaaatc       180
     agttccagct caacagctca aattatccgc gctctctatg agacaggatt tttccagtcc       240
     gtttcgcttg aacgccaagg gaatgtgttg gtggtcaatg tgatagagcg agcaactatt       300
     ggctctatta ccgttgtagg aaataaggaa ataccctctg ataaaatgaa ggcttttctt       360
     aaagaaatgg gtctggtcaa aggcagagta tttcaaagat cttccttgga gcgtttggag       420
     aaggagctga aacaggccta cacagccaga gggaagtata attctcgcat tgaaactaaa       480
     gtaactcctc ttactgaaaa tagagtagcc attagtatta ctgtatcaga aggtcgagtt       540
     tcacggatta aagaaataaa aataattggt aaccatgatt ttaaagcaaa tgagttattg       600
     cctgaattga cgttaagtac aagcaatctg tttacttatt ttactaaaaa agatcaatat       660
     tccaaaccag gaatggatgc ttctttagaa gcattacgtt cattttattt agatagggga       720
     tatttaaaat ttaatgttgt ctcttcgcaa gttttgctat cgcctgataa aaaagacgtc       780
     tatatcaata ttcatataga agaaggacct caatatcatt tctcaggtta tgatgtggtt       840
     ggaaaaacga tattacctaa agaaaaaatt gattcactga tccaggttaa gaaaggcgat       900
     gttttttctc gtaaaaaggt tactgaatcc atctctgcaa tagggttagc tttaggggat       960
     gtaggatatg gttttcccgc gattaatgcc gaacctcgaa tagatgaaaa taataaaaca      1020
     gtatttatta cttttgtagt gcagccgggc cgtcatgttt atgtgagacg tattaatttt      1080
     catggtaata cgaagacagg agattatgtt ctacgtaatg tgattcgtca ggatgaaggt      1140
     gggctactgt ctttacataa catcaaggaa tctgagcgtc agttacgaat gctgggttat      1200
     ctaaaaaata ttgatgtcaa aacgacgcct gttccaggaa ccaataatca ggtcgatctg      1260
     gatgttaatg tggaagaagc tccttcagca gaagcaagcg catccatggg atatggtaca      1320
     aacggttatc aatttaatgc atccgttaac caacgcaatt ttatgggaag tgggcgttcc      1380
     atgggggctg ctttcaatgc aagtcaatgg gggcaagact actcttttaa ctattataat      1440
     ccgttctata ccgatactgg ggtaggccgg ggaggaagct tatattattc aaggattgat      1500
     cctaaaaatt taaatgtcag tacatacagt tctaatcgct atggtggcga catcagctat      1560
     aatttcccgt taggtgagaa aagcagtttt caattgggat atggttatca agatatcaat      1620
     attaagtcag tgggttacgt actccccata atcaacttcg ttgctttaaa cggtaatcat      1680
     tttcaggaaa tcaggttgac atccggttgg agtagaaaca gctatgatca aatgccttat      1740
     cctaaccaag gatttaatca acaagctatt gctatggtcg cattgccagc aacatcgcaa      1800
     tctctatctt actataagag ctcttatcag gcgcatttat attatcctct aacccgcggc      1860
     tggatttttt ctgtcctggg taatgtgggg tacggaaata cttttgataa tttcggatta      1920
     cccttttttg aaaactacta tgccggtggt ccagtgcaac caggccaggt tcgagggtac      1980
     gatagttatt ctttaggccc gcaagataat tttggaaatg caatgggtgc gaatttcctt      2040
     gtgaatggaa gtgtaggcct gatactacca tacccattga gtcgagataa tgtaagaacg      2100
     actatttttg ctgatgcggg taatgtattt gcttccggga cacctcctgc tttacgtgga      2160
     actccggcag gtccgatgcg ttattcagct ggtgtgtcat tagaatggcg ctcacctttt      2220
     ggtccattgt cttttagctt ggctaaggca ttgaatccac agccattgga tcagactcaa      2280
     ctgttccaat ttgctctttc ctcaggtttt tag                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page