(data stored in ACNUC7421 zone)

EMBL: CP000675.PE564

CP000675.PE564       Location/Qualifiers
FT   CDS_pept        601092..601592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2838"
FT                   /product="outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2838"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56739"
FT                   /protein_id="ABQ56739.1"
FT                   /translation="MKRLGAVLVALFLGLFGTTVFADWAKIGVVDLQKIMQTSNQMKEI
FT                   QQKLEKEFKPRRDKLVAMEASLKSDMEKFKRDSAIMSASQKKELEKKIVASQQQFERDG
FT                   QQYQQELSTAHNEAMEGLYNKVRTAITKIAKDEKYDIIVQKDAAPFSSESLDVTDKVIK
FT                   AIN"
     atgaaacgtc tgggtgcggt gttagtcgca ttatttttgg gtttgttcgg cacgactgtg        60
     tttgctgatt gggcaaagat aggtgtagtt gatttacaaa aaatcatgca aacctcaaat       120
     caaatgaagg aaatccaaca gaagttggaa aaagaattta agcctcgtcg agacaaactt       180
     gtcgcaatgg aagcaagttt gaaaagcgac atggaaaaat ttaagcgtga tagtgctata       240
     atgagcgcga gccaaaagaa agaattggaa aagaaaattg ttgcgtcaca acaacagttt       300
     gaacgtgatg gacaacaata tcagcaagaa ttgagcacgg ctcacaatga agctatggaa       360
     ggtttgtata ataaggttcg tactgccatt accaaaattg ccaaggatga gaagtacgat       420
     attattgttc agaaagatgc agcgcccttc agcagcgaat ctcttgatgt aacagataaa       480
     gttatcaaag caattaatta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page