(data stored in ACNUC7421 zone)

EMBL: CP000675.PE566

CP000675.PE566       Location/Qualifiers
FT   CDS_pept        602743..603195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2836"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56737"
FT                   /db_xref="GOA:A5IH87"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH87"
FT                   /protein_id="ABQ56737.1"
FT                   /translation="MNESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINE
FT                   NFFTGHFPGNPIMPGVLMLEALAQACGILANLSRQPKEGYEFLHYFAGIDNARFKQVVI
FT                   PGDQLRLEVRLAGQKRDFWRMHGEAYIGDKLACSADLLSAAKEIKK"
     atgaacgaat cgatagatat aaatcaaatt tttactttgt taccacaccg ctacccattt        60
     attctggttg atagagtgat agattacaaa gtaatggaat atttgattgc aatcaaaaat       120
     gtgactatta atgagaactt ctttaccggg cattttccag gaaatcctat tatgcctggg       180
     gtactaatgc ttgaggcctt agcccaagct tgtggcattt tagccaattt gtctcgccaa       240
     cccaaagaag ggtatgagtt tctgcattat tttgctggta ttgacaatgc tcggttcaag       300
     caagtagtga ttcccgggga tcagttgcga ttagaggtga gactggctgg acaaaaaaga       360
     gatttttggc gtatgcacgg agaagcttat attggtgata aattggcttg ttccgcagac       420
     ttattaagcg cagcaaagga aattaaaaag tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page