(data stored in ACNUC7421 zone)

EMBL: CP000675.PE574

CP000675.PE574       Location/Qualifiers
FT   CDS_pept        607777..608589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2828"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56729"
FT                   /protein_id="ABQ56729.1"
FT                   /translation="MSMYDKRQFFKTYFSSASEKSILVKLLDKRFHPPFHTANILDLGC
FT                   HDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTAEDYFD
FT                   VCTDHFDWIFASQCLYWSPDLPKIIKQIHEAGDSALIVIRGCHGIYEIQSQFRHYIGNH
FT                   LEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEESLGDKI
FT                   FCEVRDWITSRASGSIHHEVHFFWLGNAIFTGDYNRNFPVKSKKNSMG"
     atgtctatgt atgataagcg ccagtttttt aaaacctatt tttctagcgc aagcgagaag        60
     tcaatcctgg taaagctgtt ggataaacga tttcatcctc cctttcacac tgcgaacata       120
     ttggatttgg gttgccatga tggcgcattg atgaaaaata tagtgaatgc gtacgcaaag       180
     cgtttaccgg aaaagttagt tattaccgga gtggatccta gtttgcaagc aattaaagaa       240
     tatgcaaaag cagattttcc aattccagtc caaacgaata cttttgctgg aactgcagaa       300
     gattattttg atgtgtgcac tgaccatttt gattggattt ttgcatcgca gtgtttgtat       360
     tggtcccctg atttgccaaa aataattaag cagattcatg aagcagggga ctccgcttta       420
     attgttatca gaggatgtca tggaatttat gaaattcaat cgcaattcag gcattatatt       480
     gggaatcatt tagagaaatt ttatactgat aaagaagttg agatggcctt aaggacccaa       540
     aaaattttat ttcaaaaaga atctctaagt acttctatcc ggttgcctga taaagacagc       600
     attgaattga aatggctgat tttgtttttt ttgcaaatgg aagaggaatc gttgggtgat       660
     aaaatatttt gcgaagtgcg ggattggatt acctctcgag cgtcaggaag cattcatcat       720
     gaagttcatt ttttttggtt agggaatgcc atttttacag gagattacaa taggaatttc       780
     ccagtcaaat cgaaaaaaaa ttctatggga taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page