(data stored in ACNUC7421 zone)

EMBL: CP000675.PE576

CP000675.PE576       Location/Qualifiers
FT   CDS_pept        complement(609848..610696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2826"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56727"
FT                   /protein_id="ABQ56727.1"
FT                   /translation="MTDLRTEIESLIHEGLLPDREYVSAKRFINHYATTSKFWDGLALV
FT                   GITPIINGLYAGYYASRAVWATLRTVGNLLILKPGLAFDAIKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVELLTRVISSWFVGQEQRYDLLETGLMAKWANRANGYQMVNELPSSNYFNKA
FT                   RFFSSYNNAWDCLEQMASPITSLAKSGFHSLVEALYGVDSAIECIVNLAICKPLHAKEN
FT                   FYNLQVHFGLALSLAVMAPINALVEGIAFMTRLGTTWVSACLKPEVTETEQENTTAYQF
FT                   N"
     atgacagacc ttagaacaga aattgaatcg ctcattcatg aaggattatt gccagataga        60
     gaatatgttt cagccaagcg ttttattaat cactatgcca ctacaagcaa attctgggat       120
     ggtttggcat tagtaggaat tacgcctatt atcaatggat tatatgctgg ctattatgcc       180
     tcaagggcag tatgggcaac cttgcggact gtaggtaatt tattaatttt aaaaccaggc       240
     ttggcattcg acgcgatcaa agatgtgggt tgtcatttga ctctctctac ttgtttacta       300
     cttatggctc caattcacgc tctgactcat gcagttgaac ttctgaccag agttatatca       360
     tcatggtttg ttggacaaga acaacgctat gatttattag aaaccgggct tatggcaaag       420
     tgggcaaaca gagcaaatgg ataccaaatg gttaatgagc tgccttcatc caattacttc       480
     aataaagcca ggttcttttc ttcttataac aatgcttggg attgtctaga acaaatggca       540
     tccccaataa catccttggc taaaagtgga tttcattcat tagtcgaagc gttgtatggg       600
     gttgattctg ccatagagtg tattgtcaat ttggctatct gtaagccttt acatgcaaaa       660
     gagaatttct ataacttaca agtacatttt ggtttggctc tctctttggc tgtgatggca       720
     ccaattaacg ctctggtcga aggaattgcc tttatgacac gtcttggtac tacctgggtt       780
     tctgcttgcc tcaaaccaga agtgactgag actgagcaag agaatacaac cgcttatcaa       840
     ttcaactaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page