(data stored in ACNUC7421 zone)

EMBL: CP000675.PE577

CP000675.PE577       Location/Qualifiers
FT   CDS_pept        complement(611033..611500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2825"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56726"
FT                   /protein_id="ABQ56726.1"
FT                   /translation="MNAENNVLNTLNSLSKEINKLYGYVTIAGDNFGEPAINSGPCGPF
FT                   ANAFYKIWNQKFTEKVNIAFIMMKNSDECWHILIRLPNGLLFDGGFGVHNEDKWNKDTF
FT                   DIEDMLEYDLQLLEKHSGGLNRTYPRCCPDFSIDVITNLIHKHLELVEKNK"
     atgaatgccg aaaataatgt tcttaatacc ctaaatagct tatctaaaga aataaataaa        60
     ctctatggtt acgtcaccat tgctggggac aattttggcg aacctgcaat taactcaggc       120
     ccttgtggcc catttgccaa tgctttttac aagatttgga atcaaaaatt tactgaaaaa       180
     gtaaatattg catttattat gatgaaaaat tctgatgaat gctggcatat cttaatccga       240
     ttacctaatg ggttgctttt tgatggaggt ttcggtgttc ataatgaaga caaatggaat       300
     aaagacactt tcgatataga agatatgttg gaatatgacc ttcagctttt agagaagcat       360
     tctggtggtt taaacaggac atatccccgg tgttgccctg atttttcgat tgatgtcatt       420
     accaatttaa tacacaaaca tctggaactg gttgaaaaaa ataagtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page