(data stored in ACNUC7421 zone)

EMBL: CP000675.PE579

CP000675.PE579       Location/Qualifiers
FT   CDS_pept        complement(612208..612816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2823"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56724"
FT                   /protein_id="ABQ56724.1"
FT                   /translation="MTPHIIGISGITGAGKSTLAKALSLDLKATLISWDDFDDISLEPE
FT                   DYIEWYHKGCNYSEFQREDLAKVLAELKAKREIMHPVLRTLLNPAEYIIFDAPLGKLHV
FT                   QTGEYIDTCVHIEVPLDISLCRRILRDFKDKLQTKENLLEEISFYLNHSRPLFFDDELK
FT                   QNATIVIDGLLSTEVQIQIVKNFLIGKQDDKIKKPGYLS"
     atgactcctc atattattgg cattagcggt ataacaggcg ctggaaaatc cactttggca        60
     aaagcattgt ccctggattt aaaagcaact cttatttcat gggatgactt tgatgacatt       120
     tctttagaac ccgaagatta tatcgagtgg tatcataagg gttgtaatta cagtgaattt       180
     caaagggaag accttgcaaa ggttttggca gagcttaaag caaaaagaga aattatgcat       240
     ccagtcttac gcactttgct caaccctgcg gaatacataa tttttgatgc tcccttaggg       300
     aaacttcacg tacaaacagg tgaatatatt gatacctgtg ttcatattga ggtgccactt       360
     gatatttcat tgtgccgtcg cattttgagg gattttaaag ataaattaca aactaaagaa       420
     aatcttcttg aagaaatcag tttttattta aaccattcaa gacctttgtt ttttgatgat       480
     gaactgaaac aaaatgccac tatagtcatt gacggtctcc taagtaccga agtgcaaatt       540
     caaatagtca aaaatttttt aattggtaaa caagatgaca aaattaaaaa acctggatac       600
     ttatcttag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page