(data stored in ACNUC7421 zone)

EMBL: CP000675.PE58

CP000675.PE58        Location/Qualifiers
FT   CDS_pept        complement(59300..59494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54058"
FT                   /protein_id="ABQ54058.1"
FT                   /translation="MIFAISRYDIRQTSLSLVHDLYAFQALDVVLLCISRSLKKYPKER
FT                   KNQINQTYEKPQDQSKKCF"
     ttgatttttg ccatctctcg ttatgatatc aggcaaacaa gcttgtcttt ggtacatgat        60
     ctatacgctt ttcaagcttt ggatgtcgtt ttgctgtgca tttccagaag tttgaaaaaa       120
     tatccaaaag aacgtaaaaa tcaaattaac caaacttacg aaaaacccca agatcaaagc       180
     aaaaaatgtt tttaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page