(data stored in ACNUC7421 zone)

EMBL: CP000675.PE583

CP000675.PE583       Location/Qualifiers
FT   CDS_pept        614497..615231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2819"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56720"
FT                   /protein_id="ABQ56720.1"
FT                   /translation="MKEYISALSIDRLTSYEILCPSKVDTDIIGAYHWNLLISQAFYPF
FT                   IHSVEVALRNSIHHAATKKFENEFWFDIVVTDGKSRSILEDTKNDLHRRFGQVTASDIV
FT                   AGLTFGFWTNLIKQKTYTDQFNPNRLWPDLIPSVFPHYARGHDDRKNISKRFEEIRLIR
FT                   NRLFHHEPIWKFKNAQTPQECIAELRRKFNDTFKAIGWISKYKRNCLREFGFVESFKNN
FT                   CTLETLESYKVKGAEILQQLAD"
     atgaaagaat atattagtgc attatcaata gataggctta caagctatga aatattatgt        60
     ccaagtaaag tggatacgga tattatagga gcttatcatt ggaatttatt gataagccaa       120
     gcattttatc ccttcataca ttcagtagaa gttgcattac gtaattcaat tcaccacgca       180
     gccaccaaga aatttgaaaa tgaattttgg ttcgatatcg ttgtaactga tggtaagtca       240
     agatcaattc ttgaagatac caaaaacgat ttacatcgta gatttgggca agtaacagcg       300
     tcagacattg ttgcaggatt aacatttgga ttttggacaa atttaataaa acaaaaaaca       360
     tacactgatc aatttaatcc aaatcgacta tggcctgact taattccttc ggttttcccc       420
     cattatgcaa gagggcatga tgatagaaag aatatttcca agcgatttga agaaataaga       480
     ctgattagaa atcgcttgtt tcatcacgag cctatctgga aatttaaaaa tgcccaaaca       540
     ccgcaagaat gcattgctga attgcgtcgt aagttcaatg acacatttaa agcgattggc       600
     tggatatcaa aatacaaacg aaattgttta agagaatttg gttttgttga atcgtttaaa       660
     aacaattgca ctcttgagac cttggaaagc tataaagtga agggtgctga aatattacaa       720
     caattagcag attaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page