(data stored in ACNUC7421 zone)

EMBL: CP000675.PE59

CP000675.PE59        Location/Qualifiers
FT   CDS_pept        complement(59495..60229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0059"
FT                   /product="transferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54059"
FT                   /protein_id="ABQ54059.1"
FT                   /translation="MLNKLMWLTGKAQEDWIEKILHLRQKIWPDYQRIKNDTLFKLYSH
FT                   YPLYQWLSHYNGEVVAVINSLPVALAQSLDNLPQEGLNWVLSHLASTIPLTPSNYLAAV
FT                   SVTVNPAYQRLGLSKLLLNRLKASAQEAQYKALIVPARPSQKENYPLISLEDYLKWKRV
FT                   DNTIFDPWLRVHAQLGGKIAYPCQQSRVITANIAQWEQWFGHPLLQTGQYLVKGGLNPV
FT                   TINKEKDIGIYIEPNVWVIHDL"
     atgctcaata aacttatgtg gctaactggc aaggcgcaag aggactggat agagaaaatt        60
     ctacatttac gacaaaagat ttggcctgat tatcaacgca ttaaaaatga cactcttttt       120
     aagctctata gtcattatcc tttatatcaa tggctatctc actataatgg tgaggtagta       180
     gctgttatta attctttgcc agtagcactt gctcaatcac tcgataattt gccacaagaa       240
     ggattaaatt gggtcctgtc tcatctggca tctacaatac ccttaacccc atcaaattat       300
     cttgctgctg tatcagtgac tgtgaatccg gcttaccaaa gacttggttt aagcaaactc       360
     ttattgaatc ggttaaaagc cagtgcacag gaggctcaat ataaagcact aatagtgcca       420
     gccagaccta gccaaaaaga aaactaccct cttatttccc tagaggatta tttgaagtgg       480
     aaaagagtgg ataatactat ttttgatcct tggttaagag ttcatgcaca actgggagga       540
     aaaatagctt atccatgcca gcaatcacgc gtgatcacag cgaatattgc tcagtgggaa       600
     caatggttcg gccatccgtt acttcaaacg ggtcaatatc ttgttaaagg cgggttaaat       660
     cctgtcacta tcaataaaga aaaggatatt ggaatataca ttgagccaaa tgtttgggtt       720
     attcatgatt tgtag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page