(data stored in ACNUC7421 zone)

EMBL: CP000675.PE594

CP000675.PE594       Location/Qualifiers
FT   CDS_pept        623515..624258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="LPC_2808"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56709"
FT                   /protein_id="ABQ56709.1"
FT                   /translation="MKKIKQWLNTKRPEKKNEALTENPFLNARRAWNVHTAGLMKSVQV
FT                   WQLVGLSSLLLALAAVGGLISIGSQSKFIPLVFQQDANGNTLSVTRADRVGQANIDDYR
FT                   AAAAHFIENIRMVSSDVELQKKAVFQVYSYLNQNDAALAKVQEFYSNKQQSNPFERATH
FT                   EIVSIEIRSVLQESDETWQVDWVETVRNRDGTLKEKPYVMKAMITMYQDNELNDVSSES
FT                   ILKNPHLIFIRDFNWSYELKHGEQR"
     atgaaaaaaa taaaacaatg gcttaatacc aaaagacctg aaaagaaaaa tgaagcgtta        60
     acggagaatc cctttcttaa tgccagacgc gcctggaatg ttcataccgc agggcttatg       120
     aaatcggtac aggtttggca actggtgggc ttaagcagcc ttttattggc actggccgct       180
     gttggtgggc ttatatccat tggcagccag tccaaattta tccctttggt atttcagcag       240
     gacgctaatg gcaatacctt gtcagtcacc cgtgcggata gggttggaca agccaatatt       300
     gatgattatc gggcggctgc tgcacatttt attgaaaata tccgcatggt aagtagcgat       360
     gttgaactac aaaagaaggc tgtgtttcaa gtttattcct atttaaatca gaatgatgcg       420
     gctctagcca aagttcagga attttacagt aataaacagc agtctaatcc ctttgaaaga       480
     gcgacgcatg aaatcgtcag cattgagatt cgatcagttc tacaagagtc tgatgagacc       540
     tggcaggttg attgggttga gacggtgaga aatcgtgacg gaacgcttaa agaaaagccc       600
     tatgtgatga aagccatgat cacgatgtat caggataacg aacttaatga tgtctccagt       660
     gagtctattt tgaaaaaccc acacttaatt tttatccgtg attttaactg gtcctatgaa       720
     ttaaagcatg gagaacagcg atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page