(data stored in ACNUC7421 zone)

EMBL: CP000675.PE596

CP000675.PE596       Location/Qualifiers
FT   CDS_pept        625133..625543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2806"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56707"
FT                   /protein_id="ABQ56707.1"
FT                   /translation="MKELSVLLFALLLSSCASQRYGNFTQVSQGRDVYLAQDAASQLTR
FT                   VYPPAQNTFCISQKVRDAFGISLIHEMRKKGYGVIENNCPKQKANFFYVVDEIKATNLY
FT                   RVSLFIGSQTFSRIYAKTGGKIPPVSAWTHKE"
     atgaaggaac taagtgtttt attgtttgct ctattgctat caagctgtgc aagtcagcgt        60
     tatgggaatt ttactcaagt atctcaaggc cgagacgttt atttggcaca agacgcggca       120
     tcccaattaa cacgtgtcta tccacctgct caaaatacgt tttgcatcag tcaaaaggta       180
     agggatgctt ttggcatcag cctgattcat gaaatgcgaa aaaaaggtta tggcgtgatt       240
     gaaaacaatt gccccaaaca aaaggccaat tttttctatg ttgtcgatga gattaaagca       300
     accaaccttt accgagtcag cctttttatt ggctcacaga ccttcagcag aatttatgcc       360
     aaaaccggtg gaaaaattcc cccagttagc gcatggactc ataaggagtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page