(data stored in ACNUC7421 zone)

EMBL: CP000675.PE598

CP000675.PE598       Location/Qualifiers
FT   CDS_pept        626815..627555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_2804"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2804"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56705"
FT                   /protein_id="ABQ56705.1"
FT                   /translation="MKFRIMLIYLWTLHVFASGAPVFDFANWIENGKIILNQVSQYKTQ
FT                   IDQYNNQLQQYQNMLENTKSLTSFQWDNANSVINNLLESTNTIDYYKQEAGSLQGYLDR
FT                   FQSQEYYQKTPCFNGNGHCSPEELRKIKQSRLSTSVAEKRANDAMLKGIDKQQQSLKDD
FT                   SEKLRVLQSQAQSAVGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQAVKDAANANK
FT                   EAIQAAGDEQFRAGTYHKSSGKKW"
     atgaaattta gaatcatgct tatttattta tggacactac atgttttcgc cagcggtgcg        60
     cccgtatttg attttgccaa ttggattgaa aatggaaaaa tcatactgaa tcaggtgagt       120
     cagtataaaa ctcagatcga tcaatacaac aatcagctgc agcaatacca aaatatgtta       180
     gagaacacta agtcgctcac ttccttccag tgggataatg ccaactctgt cattaataat       240
     ctgcttgaat cgactaatac aattgattat tacaagcagg aagcaggcag ccttcaaggt       300
     tatctggacc gatttcagag ccaggaatac tatcagaaaa ctccttgttt taatggtaat       360
     ggtcattgct cacccgaaga actcaggaaa atcaaacaaa gtagactctc aacttctgtt       420
     gccgaaaagc gtgctaatga tgccatgctc aaagggattg ataagcaaca acagagcttg       480
     aaagatgact cagaaaaact acgggtcttg caatctcagg cgcaaagtgc cgttgggcaa       540
     aagcaagcac tacaggctgc ttcacaatta gccagcaatc aatcacatca attacttcaa       600
     atcagagggc ttttattagc acaacaaaac gcgcaggcgg taaaagatgc ggcaaacgcc       660
     aataaagagg ccatacaggc cgcgggtgat gagcaatttc gagcgggtac gtatcataaa       720
     agttcaggta aaaaatggta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page