(data stored in ACNUC7421 zone)

EMBL: CP000675.PE60

CP000675.PE60        Location/Qualifiers
FT   CDS_pept        complement(60219..60923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54060"
FT                   /protein_id="ABQ54060.1"
FT                   /translation="MIREYMDKRNNQFTTEILNYFSDLKKFSTSYLGWLTMEHYQFSLN
FT                   NTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLDVTNRIPYVATR
FT                   QFFMRLEALIEVNASKTLGVMYATETAAIFEHILFKEISAELCQRKRLDFENSRIKQFH
FT                   DLHLDGVEQAHKDELGKFMDHTLAQEHVDPNIFLQEKEIIDGAYAAIDIMEDWWSGLIN
FT                   AKAHLLEQAHAQ"
     atgataagag aatacatgga taagagaaac aaccaattta ctaccgaaat tttaaattat        60
     tttagtgacc taaaaaaatt ttcgacgagc tatcttggat ggctaaccat ggagcattat       120
     caattttcgt taaacaatac tcgtttctta atgaattctc atatccaaac caagtcgctt       180
     tctgatcccg gagtttctga agagttactc gctaactata acgaagaaaa aaatcatgct       240
     caaatgtacc ggcatgcact aaaaaaaatt ggcctggatg taacaaacag gattccgtat       300
     gtggcaacca gacagttttt tatgcgcctt gaagccttga ttgaggttaa cgcatccaaa       360
     accctcggcg ttatgtacgc tactgaaaca gctgcaatat ttgagcatat tttatttaaa       420
     gaaataagcg ccgagctttg tcaaagaaaa cgtttggatt ttgagaattc tcgcatcaag       480
     caattccatg atttacacct ggatggagta gaacaggcac ataaagatga gttaggcaag       540
     tttatggatc atacgcttgc tcaagagcac gttgatccca atatttttct ccaggaaaaa       600
     gaaataatag atggcgcata tgcggcgatc gatataatgg aagattggtg gtccggttta       660
     attaacgcaa aagcacacct tttggaacaa gctcatgctc aataa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page