(data stored in ACNUC7421 zone)

EMBL: CP000675.PE601

CP000675.PE601       Location/Qualifiers
FT   CDS_pept        629193..631082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="LPC_2801"
FT                   /product="Conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56702"
FT                   /protein_id="ABQ56702.1"
FT                   /translation="MSLNKPNKAIGPQVRQKHNEKTNKQLVILVALSLFISMQVGTQFV
FT                   AYKLHFSDELGFSLNHVYFPWQSLWWSLKYHHYYPDYFNAAFGLMAMSGSLFLMLIVFV
FT                   AKHLKKENISEYLHGSARWANRDDLKNAGLFGNEEGVYVGAIEDEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRAGTEYEVGDVQNLATLVIDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHVDGKTHFVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPIVAYNVSASDFCIKDLMHHASPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADKMEFERVDDGRGNYFVRTKKTYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHTTTSGKRFSTFLNQISKTKQEVSRPLLTVDECQRMPGPKKDENGLIKEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVEAPEQSDILRARLREDEEIRL"
     atgagcttga ataaacccaa caaagccatt ggcccacagg tgaggcaaaa gcataatgaa        60
     aaaacgaata aacaacttgt tattttagtt gccctctcgc ttttcatcag tatgcaggtt       120
     ggcacacaat ttgtggctta taagttgcat tttagtgatg aattagggtt ttcgctgaat       180
     catgtctact ttccatggca gtctctttgg tggagcttga aataccatca ttattatcct       240
     gattatttta atgcagcctt tggtttgatg gcgatgagtg gcagtctttt tttaatgttg       300
     attgtttttg ttgctaagca tttaaaaaaa gaaaacatca gtgaatacct gcatggttca       360
     gccagatggg ccaacagaga tgatttaaaa aatgctggac tgtttggcaa tgaggaaggc       420
     gtttatgtcg gtgctattga agatgaaaaa ggggatattc attatttacg ccataatggc       480
     ccagagcata ttttaactta tgccccaacg cgttctggca aaggggttgg tcttgttatt       540
     cctacccttt tatcctggaa acagtcttgt gtgattacgg atttaaaagg agagctttgg       600
     gcattaacag ctggttggcg tcaaaagcat gccaacaata aagtcattcg ctttgagccg       660
     gcaacattaa agggttcagc ccgatggaat ccattagatg aaattagagc aggtacggaa       720
     tatgaagttg gtgatgtaca aaatcttgca acgcttgtaa ttgatcctga tggtaaagga       780
     cttgaaaccc actggcagaa aacatcccaa gcacttttgg ttgggtttat tctacatgca       840
     atttataagc tgaaaaatca aggagaaccg gctacttttc caaatattga tcgcatgttg       900
     gtcgatccaa ataccaacat cgccgattta ttgattgaaa tgactcaata cccacatgtt       960
     gatggcaaaa cacattttgt tatcagcgca tcggctcgcg atatgattga taggccggag      1020
     gaagaagcag gttctgtctt gtccacctta aaatcgtacc tggctttata ccgtgatccg      1080
     atagttgctt acaatgtctc tgcatcagat ttctgtatta aagatttgat gcatcatgca      1140
     agccctgtca gtctttatat cgtgacccaa cccaatgata aagcacgatt acagccttta      1200
     gttcgggtta tgctgaatat ggttgtccgc cttttggcgg ataaaatgga atttgaacga      1260
     gtcgatgatg ggcgagggaa ttatttcgta agaacgaaga aaacctataa acatcgcctg      1320
     ttgtgcatga ttgatgaatt cccaagtctt gggaagcttg atattttaca agagtcattg      1380
     gcgtttgttg ccggttatgg tttgaagttt tatttaatct gccaggacat taatcaactt      1440
     aaaagtcgtg agcgcggcta tggcccagat gaaaccatca cctcgaactg tcatatccaa      1500
     aatgcctatc cgcccaaccg aattgaaacc gccgagcatc tttcaaaact aaccggccag      1560
     actactattg taaaagagca taccactact agcggtaaac ggttttcaac ctttctaaat      1620
     cagatttcaa aaacaaaaca agaagtttct cgaccgcttt tgacggttga tgaatgtcaa      1680
     cgtatgcctg gaccaaaaaa agatgaaaac ggtttaatca aggaagcagg cgatatggtg      1740
     gtgtatgtgg caggatttcc tgccatttat ggcaaacagc cgctttattt taaagaccct      1800
     gtgtttatcg ccagagcttc tgttgaagcg ccagagcaat cagatatctt acgcgcccgc      1860
     cttcgtgaag atgaggaaat cagactatga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page