(data stored in ACNUC7421 zone)

EMBL: CP000675.PE602

CP000675.PE602       Location/Qualifiers
FT   CDS_pept        631079..631624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="LPC_2800"
FT                   /product="Plasmid transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2800"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56701"
FT                   /protein_id="ABQ56701.1"
FT                   /translation="MKKFTSWIAVLMLSIIGMAFLFMLMGFRVNTTDSIPFGLYRITNI
FT                   KNIKNAYVIFCPDDRPVFKQGLDRGYIGSGLCPGGYGYLMKKVVATNGDQISITSDGVF
FT                   VNRQLILFSKPTLIDGRKRPLPQWRTIDYQIKEDELITMTSQSECSFDSRYYGPIRIGQ
FT                   IKGVIKPIWVNATSGEIA"
     atgaaaaagt tcacttcctg gattgctgtt cttatgttaa gcatcatcgg catggcattt        60
     cttttcatgc tgatgggctt tcgcgtgaac actacagatt ccattccttt tggcctttat       120
     cgcattacaa atataaaaaa catcaaaaat gcctatgtga ttttttgccc tgatgatcga       180
     ccggttttta aacagggatt agatagaggc tatatcggaa gtggcctttg ccctggcggt       240
     tatgggtatt taatgaaaaa agtggtggca acaaatggtg atcaaatatc tatcacctcc       300
     gacggcgttt ttgttaatcg ccaacttatt ctcttttcaa aaccgacatt aatagatgga       360
     aggaaacgac ctttgcctca atggcgcacc atagattatc agatcaaaga agatgaactc       420
     ataaccatga ctagccaaag cgaatgctct tttgatagtc gttattatgg ccctattcgg       480
     atagggcaaa ttaagggagt aattaaaccc atatgggtaa atgcaacaag tggagaaata       540
     gcatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page