(data stored in ACNUC7421 zone)

EMBL: CP000675.PE603

CP000675.PE603       Location/Qualifiers
FT   CDS_pept        631621..631785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="LPC_2799"
FT                   /product="traD protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2799"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56700"
FT                   /protein_id="ABQ56700.1"
FT                   /translation="MNKEAELMDVISEKLDDLMVPGFIAEVTPIEAEIMGAFSEDALSA
FT                   YDAKEAAYD"
     atgaataaag aagctgaatt aatggatgta atttcagaaa aattagatga tttgatggtt        60
     ccgggtttta tcgccgaagt cactcccatc gaggcagaaa tcatgggtgc cttttctgag       120
     gatgcgctta gtgcttatga cgctaaggag gcggcctatg actaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page