(data stored in ACNUC7421 zone)

EMBL: CP000675.PE605

CP000675.PE605       Location/Qualifiers
FT   CDS_pept        complement(633966..634424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2797"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56698"
FT                   /protein_id="ABQ56698.1"
FT                   /translation="MTVQLIKNFDINIDRYPNQYVGCLVLTKDNKILLQQRPHDWPTYP
FT                   DYLCEFGGRIEHNESPEQAVIRDLEEELGGDVKLKELVSFGAITESMSKHKELIHTFFW
FT                   HDKEGTITGCYEGLPRFFNESAHILLQTKITDGLRWLIDESKKLHLIK"
     atgactgttc aattaataaa aaatttcgat atcaatatag accgctaccc aaatcaatat        60
     gtaggctgcc ttgttttaac caaagataat aaaattctat tacaacaacg ccctcatgac       120
     tggccaacat accctgatta tctttgtgaa tttggcggca gaatagaaca taatgagtcg       180
     ccagaacaag ctgtaatccg tgaccttgag gaagagttag gcggtgatgt aaagctcaaa       240
     gaactcgtat catttggtgc aatcactgaa tccatgtcaa agcataaaga attgatacat       300
     acttttttct ggcatgataa ggaaggaaca ataacgggtt gttatgaagg cttgccgcga       360
     ttctttaatg aaagcgccca tattttatta caaaccaaga ttactgatgg ccttcgctgg       420
     ttaattgatg aaagtaagaa acttcacctt atcaaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page