(data stored in ACNUC7421 zone)

EMBL: CP000675.PE608

CP000675.PE608       Location/Qualifiers
FT   CDS_pept        complement(637172..637525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="LPC_2794"
FT                   /product="traJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2794"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56695"
FT                   /protein_id="ABQ56695.1"
FT                   /translation="MDDKNKSPSRKHGRHLRVPVLPDEEISIKSHAAQAGLSVAGYLRR
FT                   IGLGYQIHSAIDKDYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDHRKVKALLDRIQ
FT                   TMQAAMFEVVKKL"
     atggacgata aaaataaatc accttccaga aaacacggtc gccatcttcg tgttcccgtc        60
     cttcccgatg aagaaatttc tattaaatcc catgctgccc aagcgggact ttctgttgcg       120
     ggatatttgc gccggattgg gttgggctat caaatccaca gcgccataga caaagattac       180
     attctccagt tatccaaaat aaatgcagac atgggaaggc ttggcgggct gtttaagcta       240
     tggcttaccc aggatagacg tgtcgcacat tttgatcacc gaaaagtaaa agccttattg       300
     gatcgcattc agacaatgca ggctgcaatg tttgaagtgg tgaaaaagtt atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page