(data stored in ACNUC7421 zone)

EMBL: CP000675.PE612

CP000675.PE612       Location/Qualifiers
FT   CDS_pept        639466..641496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2790"
FT                   /product="Putative type I restriction enzyme HindVIIP M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2790"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56691"
FT                   /protein_id="ABQ56691.1"
FT                   /translation="MKNENNKKIQNLSTFSWSIAEILRGDFKQSEYGKVILPFVVLRRL
FT                   DCILEPSKDAVISAYENLPEGIDDHTKDMMLFSAVGGGLKVYNYNTLTFSKIRNQDPGD
FT                   VHKNLLDYITSFNSSVRDIFLEKFLFTDQLKRLKDGGILWQVFDRFCQIDLHPDNVSNM
FT                   EMGYLFEDLIRRFSEISNETAGEHFTPREVIRLIVDLLLINDAEALAGSGIIRTVYDPA
FT                   CGTGGMLALMEEAMKEYNSKIRVELYGQELNPESFGICTSDMLVTGHNPEQIAFGNTLT
FT                   EDAHKDKKFHYMLSNPPYGVDWKKYQDPIKQEAQEKGMDGRFGAGLPRISDGQLLFLQH
FT                   MISKMRDDEVGSRIGIVMNGSPLFTGGAGSGESEIRRWMFENDWVEAIIALPTDLFYNT
FT                   GIQTYVWMLTNKKDKNRRGKVQLIDASSERFWQSMRKSLGSKRREISDHARSEIVKIYY
FT                   EMLNGGGDWSEFSKIFDRQEFGYREIRIERPLRLNFEGSKERLELLQQENTFLKLSEIE
FT                   QQELLTALNHNTLKQQFKNRDAFEKALKTALKNLSFKLTAPLKKAILTTLSEKDETADI
FT                   CCDAKGNPEPDTDLRDHELVPLKEDWREYVEREVKPFVADAWVDENHKDATDGKVGRVG
FT                   YEINFNRYFYKYVPPRPVAEINEELKQLEAEIANLLKEVVA"
     atgaagaatg aaaataataa aaagatacaa aatctgagta cattttcatg gtctatagct        60
     gaaatactgc gaggcgattt taagcagtca gaatatggta aggttatctt gccatttgtt       120
     gttttgcgtc gattggattg tattttagaa ccttcaaaag atgctgtaat tagtgcgtat       180
     gaaaatttac ctgaagggat tgatgatcat actaaagaca tgatgctatt tagtgctgtt       240
     ggtggtggcc tgaaagttta taactacaat acgctcacct ttagtaaaat tcgaaatcaa       300
     gatccaggtg atgtacataa gaatttatta gactatatca ccagttttaa tagcagcgtt       360
     cgcgatattt ttcttgaaaa atttctcttt actgatcagc ttaagcgcct aaaggatggt       420
     ggaattttat ggcaagtatt cgatcgtttc tgccagatag atttacatcc tgataatgtt       480
     tccaacatgg agatggggta tctctttgaa gatttgattc gccgtttttc tgaaatttcg       540
     aatgagacgg caggggaaca tttcacacct cgtgaagtca ttcgtttgat tgtggatctt       600
     ttgttgatta atgatgccga agcattggct ggttcaggaa tcattcgcac agtttatgat       660
     cctgcctgtg gaacaggcgg tatgcttgca cttatggaag aggcaatgaa ggaatataac       720
     tctaaaattc gtgtcgagct ctacgggcag gaactaaacc cagaatcctt cggtatctgc       780
     acgtctgaca tgctggtgac aggtcataac ccagagcaaa ttgctttcgg taacacgtta       840
     acagaagatg ctcacaagga taaaaaattt cattatatgc tttccaatcc tccgtatggg       900
     gtagattgga aaaagtacca agaccctatt aagcaagaag cgcaagaaaa agggatggat       960
     ggtcgttttg gtgctgggct accgcgtata tctgatggac agttgctttt cctgcagcac      1020
     atgatatcaa aaatgcgaga tgatgaagta ggctcacgca ttggtatagt gatgaatggc      1080
     tctcctcttt ttacaggtgg agcaggctct ggtgaaagtg aaattcgccg ctggatgttt      1140
     gaaaatgatt gggtagaggc gattatcgca ttacctaccg atttgtttta caacaccggt      1200
     attcaaacct atgtttggat gcttaccaat aagaaggata agaaccgtcg gggaaaggtg      1260
     cagctcattg atgcaagtag cgaacgattt tggcaatcca tgcgaaaaag tcttggtagc      1320
     aaacgtcgag agatttctga tcatgcgcgt agtgaaattg ttaaaattta ttatgaaatg      1380
     ctcaatggtg gtggtgattg gagcgaattt tctaaaattt ttgataggca agagtttggt      1440
     tatcgagaaa tacgcattga gcggcctttg aggctaaatt ttgaaggaag caaagagcgc      1500
     ttagaattgc ttcaacaaga aaatacgttt ctaaaacttt ccgaaataga gcaacaagaa      1560
     ttattaaccg cacttaatca caacacatta aaacagcaat ttaaaaatcg tgatgcattt      1620
     gagaaagcac ttaaaacagc attaaaaaat ttaagtttca agttaactgc cccattaaaa      1680
     aaagcgattc ttacaacgct ttcagagaaa gacgaaactg ctgatatttg ttgtgacgct      1740
     aaaggcaatc ctgaacctga tacagattta cgcgatcatg aattagtacc tctaaaagaa      1800
     gattggcgag aatatgttga acgagaagta aaaccttttg ttgccgatgc ttgggtagat      1860
     gaaaatcaca aggatgccac cgatggcaag gtaggtcgtg tggggtatga aattaatttt      1920
     aatcgttatt tctataaata tgttccaccg cgtcctgtag ccgagataaa tgaagagctt      1980
     aaacaattgg aagcggaaat tgctaacttg ctgaaagagg tagtagcatg a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page