(data stored in ACNUC7421 zone)

EMBL: CP000675.PE613

CP000675.PE613       Location/Qualifiers
FT   CDS_pept        641493..642767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2789"
FT                   /product="hypothetical protein"
FT                   /note="similarity to MJ0130"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2789"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56690"
FT                   /protein_id="ABQ56690.1"
FT                   /translation="MNHQTFLDKFVNNYRWKSVPTKRNFRNIKQINKGLIEEHRLALTL
FT                   GGVIDRSLDDVEGLQSSDYSTYQIFEKDDLVFKLIDLENIKTSRVGYVPRRGIMSPAYI
FT                   RLTPTSELVIPRYYYWLFYAAYINNIFNGMGGGVRQNLTPTDLLEFPIPLTPKETQIEI
FT                   TNFLDREIDRIDQLIEKKKKLICLMRERESNAVREAIFSLINEGVQIWKLSHVCRVQRG
FT                   KFTHRPRNAPELYDGEVPFIQTGDVARANKFITKHKQTLSELGISVSAKFPSNTLLMAI
FT                   AANVGNLAITTYEVYCPDSIVGFIPTEKVESEYLYYVLRAISDDISSSSTSNAQDNTNV
FT                   ARLGSLKIPLPSIQKQKNLIDKFKIEENLLFKTTSKISNSITKLNEFRCALISEAVTGQ
FT                   LDIKSWKKRGSTDERLDNIEEAMRA"
     atgaaccatc agactttctt ggacaaattt gtaaataatt atcgatggaa atctgttcct        60
     acaaaacgaa actttagaaa tataaaacaa attaacaagg gtttgataga agaacatcgc       120
     cttgcactta cgcttggagg tgtaatagat agatccctag atgatgtaga gggattacag       180
     tcgtccgatt attcgaccta ccaaattttt gagaaggacg atcttgtttt taaattaatt       240
     gatttggaaa atatcaaaac tagccgagtt ggatacgttc cacgacgagg tataatgagt       300
     cccgcatata ttcgattaac acctacgtcc gaactagtga taccacgata ctactactgg       360
     cttttttatg ctgcatacat aaataatatt tttaatggta tgggtggagg tgttcggcag       420
     aatttaactc caacagactt attagaattt cctatacctc ttaccccaaa agaaactcaa       480
     atagaaataa caaatttttt ggatcgtgaa atcgatcgta ttgatcagtt gattgagaag       540
     aagaaaaaac ttatttgttt aatgagggag agagagtcaa atgctgttag ggaagctatc       600
     ttttccctta taaatgaagg ggttcaaatt tggaaattat ctcatgtatg cagagtacaa       660
     agaggaaaat tcacgcatag acctagaaat gctccagaac tttatgatgg agaggtgcct       720
     ttcattcaaa caggagatgt tgctagagcc aataagttta taaccaaaca taagcaaact       780
     ctatcagagt taggtatatc agttagcgct aagttcccct caaacacatt gcttatggct       840
     attgcggcaa atgtgggtaa tttggctatc acaacttatg aagtatactg tccagacagt       900
     attgttggtt ttattcctac tgaaaaggtt gaatcagagt acttatatta tgtacttagg       960
     gcaataagcg atgatatctc ttccagttca acaagtaatg ctcaagataa taccaatgtt      1020
     gctcgcttag gaagtttaaa aattcccttg ccaagtattc aaaagcagaa aaatctgata      1080
     gataaattca aaatagaaga gaatctacta ttcaaaacga ctagtaaaat ttctaattca      1140
     attacaaagc tgaatgaatt tagatgcgct ttaatttctg aagcagttac aggtcaatta      1200
     gacattaaat catggaaaaa aagaggtagc accgatgagc gcctcgataa tatcgaggag      1260
     gcaatgcggg catga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page