(data stored in ACNUC7421 zone)

EMBL: CP000675.PE614

CP000675.PE614       Location/Qualifiers
FT   CDS_pept        642764..645745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2788"
FT                   /product="Putative type I restriction enzyme R protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2788"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56689"
FT                   /protein_id="ABQ56689.1"
FT                   /translation="MTDTTKRAYSQDTIRRENVLQYHVIDQLVKKLGYVHRSTEDFDRA
FT                   SALDKTLVMQFIKSTQLDEWKRLQEQYSDSAETEFFKQLEKALKSRGTLDVLRQGIKLI
FT                   PGIKFSLCFFKPASGINKELLQLFEANILSVIDELKYSSKHDNRIDIGVFVNGIPLATI
FT                   ECKNQSTGTTFRHAEKQYRTDRSPAGEPLLTFKQGALVHFAMDEDNVSMTTRLANGKTR
FT                   FLPFNRGHNGGAGNPDIADEFRVGYLYADQPEGKAILSRDILLDIVGRFMHLEVKDGKE
FT                   VMIFPRFQQLDAVLRLLRHAKQHGPGHSYLIQHSAGSGKSNTIGWTAHRMITLHDEKDQ
FT                   PIFNTAIIVTDRIVLDRQLQNTVAQFEQTKGVVKKIDGTSRQLKEAIKQGARIIITTIH
FT                   KFSTDHLKEISGQSKRRFAVLIDEAHGSQSGKYADNLSKTLTREEGNNTPSDIEDMIAE
FT                   YQRQRGPQDNISYFAFTATPRNVTLERFGTKGSDGLPYPFHLYSMRQAIEEGFILDVLQ
FT                   NYMTYKQYYKLEKAIEDDPELQGRRAHRRVARFAILHPTAIAQKVEVIVEHFCRHVMQE
FT                   INGKAKAMVVTQSREHALKYYFGIKKYIEEKQYVGVKALVAFSGELEIDGETYTEAELN
FT                   GFAETQLPEKFDKDFQLLIVAEKYQTGFDQPKLCAMYIDRKLDGLQAVQTLSRLNRTTP
FT                   GKINTYVLDFQNTIEDIQNAFRPFYEVTSLEEISDPNQVYELEGRIKSFSIIDEDEVNR
FT                   FSEVFYKGALDPHDRIALEKLVKNAVQRFEYEEDEGKREEFRQLLKSYMRFYSFVAQVM
FT                   SLQDTWLEKLFSYVSWLNRLLPNREVPPEIEITDDMIRLQAFRIEKKEQGSASLSPGTT
FT                   SPLSAIKEFGANAYTEDEERSLSEIIESFNQRHGTEFTKEDFLRFEKVNQEILSDDNLK
FT                   DMLKNNPPDVVFGAFSQAFFESAIQLFQRDNQLQNIIMTDAEARNQAIKHFFSRALKKV
FT                   RNGI"
     atgacggata caactaaacg agcctactct caggacacta tccgtcgaga aaatgtgctg        60
     caatatcatg tgatcgatca gctggttaaa aaactaggtt atgtccatcg tagcacagaa       120
     gattttgatc gtgcttcagc actcgacaaa actttagtga tgcaattcat taaatcaaca       180
     cagcttgatg agtggaaacg attgcaagag caatattctg atagcgccga aaccgaattt       240
     ttcaaacaat tggaaaaagc gttgaaatct cgtggaacgc tggatgtgct gcgccagggt       300
     atcaaactta ttcctggcat taaattctct ctttgcttct tcaaaccggc ttcaggtatt       360
     aataaagaac tattacagct cttcgaggcc aatattcttt cggtgattga cgagctgaaa       420
     tatagcagta aacatgataa ccgcattgat attggcgtgt ttgttaatgg cattccattg       480
     gcgactattg aatgtaaaaa ccaatcaaca ggtacgacgt tccgtcatgc tgaaaaacaa       540
     tatcgtaccg atcgttcccc agcaggtgag ccattactaa cctttaaaca aggcgcattg       600
     gtacatttcg caatggacga agacaatgtt tccatgacta cacgattagc aaacggtaaa       660
     actcgatttt tgccatttaa ccgaggccat aatggtggtg caggaaaccc tgatatcgcc       720
     gatgaatttc gtgttggtta tctttatgct gaccaaccag aaggaaaagc catcctctcg       780
     cgagatattc tgcttgatat cgttggacga tttatgcacc tggaagtaaa agatggtaaa       840
     gaggtcatga tatttccgcg ctttcagcag ttagatgctg tattgaggtt attaagacat       900
     gcaaaacaac atggcccagg tcatagctat ttaattcagc attcagcagg ttcaggtaaa       960
     tctaatacca ttggttggac agcccaccgc atgattaccc tacatgatga aaaagaccaa      1020
     ccaattttta acacagccat tattgtgact gatcgtattg tgttagatcg ccaactacag      1080
     aatacggtgg ctcaatttga gcaaactaag ggcgtggtga aaaagattga tggcacgtca      1140
     cgacagttga aagaagctat taagcaaggt gcgcgcatta ttattactac tattcataaa      1200
     ttttcgactg atcatctgaa ggaaatttcg ggtcaaagca agcgccgttt tgcagtgctg      1260
     atagatgaag cgcatggctc tcagtccggt aagtatgctg ataacctctc aaaaactttg      1320
     acacgtgaag aaggcaataa cactccttcg gatatagaag atatgattgc tgagtatcag      1380
     cggcaacgtg gaccacagga taatatcagt tatttcgctt tcacggctac gccacgtaat      1440
     gtcacactgg agcgctttgg cacaaaagga tcggatggtt tgccatatcc attccatctt      1500
     tattctatgc gtcaagctat tgaggagggc tttattcttg atgtgttgca gaattacatg      1560
     acctacaaac agtactataa gctggaaaaa gctatcgaag atgatccgga attgcaagga      1620
     cgaagagcgc atcgccgtgt tgctagattt gcgatattac acccaactgc aattgctcag      1680
     aaagtggagg tcattgtaga gcatttctgt cgccatgtga tgcaagagat aaatggtaaa      1740
     gcaaaagcaa tggttgtcac tcaaagtcgc gaacatgcac ttaaatatta ttttggtata      1800
     aaaaaataca ttgaggagaa gcaatatgta ggtgtgaaag cgttggtagc tttttcaggt      1860
     gagctagaaa tcgatggtga aacttacacc gaagcagaat taaatggttt cgctgaaacc      1920
     caattgccag aaaaatttga taaagatttt caattattga ttgtggcaga gaaatatcaa      1980
     acaggctttg atcagccaaa gttatgcgct atgtatatcg atagaaaatt ggatggttta      2040
     caagcagtac aaaccctatc aaggttaaat cgtactaccc caggaaaaat taatacatac      2100
     gtgctcgatt tccagaatac gattgaagac attcaaaatg catttcggcc attttatgaa      2160
     gtcacgtcgc tggaggagat atctgaccct aatcaagttt atgaattgga aggtcgcatt      2220
     aagtcttttt ctattatcga tgaagatgaa gtcaaccgtt tctcagaggt tttctacaaa      2280
     ggagcgcttg atccacacga tagaatcgcg ctagaaaaat tggttaagaa tgctgtccaa      2340
     cgttttgaat atgaggaaga cgaaggaaag cgtgaagaat ttcgacaatt gctgaagagt      2400
     tacatgcgtt tttattcgtt tgtcgcgcag gtgatgagtt tgcaagacac ttggctggaa      2460
     aaactttttt cctatgtatc atggcttaat agattactgc ctaaccgaga agtgccgccg      2520
     gaaattgaga ttacagacga tatgattcgt ttacaggcat tcagaataga gaaaaaagaa      2580
     cagggttcag cttcgttatc tcctggcaca acttctcctc tatctgctat caaagagttt      2640
     ggtgctaatg cttacacgga agatgaggag cgttcattat ctgaaattat tgagtctttc      2700
     aatcagcgtc atggcactga atttactaaa gaagactttt tgcgttttga gaaagttaat      2760
     caagaaatac taagtgatga taatttgaaa gatatgctga agaataaccc gcccgatgtg      2820
     gtttttggtg ctttttctca ggcctttttt gaaagcgcga tccaattatt ccagcgcgat      2880
     aatcaattgc aaaatataat catgacagat gctgaggcac ggaatcaggc gattaaacat      2940
     ttctttagtc gggcgttgaa gaaggttaga aatggtatct aa                         2982
//

If you have problems or comments...

PBIL Back to PBIL home page