(data stored in ACNUC7421 zone)

EMBL: CP000675.PE615

CP000675.PE615       Location/Qualifiers
FT   CDS_pept        645773..647026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2787"
FT                   /product="hypothetical protein"
FT                   /note="similarity to Vibrio vulnificus VVA0689"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56688"
FT                   /protein_id="ABQ56688.1"
FT                   /translation="MSMESQDKFVAKRGKTYLNREELEAHLASVIRLENIGVLLGAGAS
FT                   ISAGGKTMSDVWKSFKDDYSDSADWLQKKTFFNDGSINVEELLDTLEIAEKEWIRQGKT
FT                   KLTKQLQKAKADLYRSIIKASVLQDKWWNSPHLVDLDDGKLDSHRALLQALCGSRQVGQ
FT                   PAPWIFTTNYDLAMEWAGETLGWKINNGFEGLHNRIFSPHVFDLGYSNLSARGEARFGT
FT                   YGFFLAKLHGSLSWQELDGEYLEYPAATIWSDIQNFLDKKDNHKLPIVFPSAAKYIQTV
FT                   GFVLGELLRRFTEFLSKSQTCLITIGYSFSDSHLNQIVKRALLNPTLQLVICLPELEKF
FT                   DGNNININKSIQSILKLESPQITIIGGKEKAFFDSFVTYLPQPVIYDEYALKIKKLINE
FT                   NKEQNTPAREDIGIGENM"
     atgagtatgg aaagccaaga taaatttgtc gctaagcgag ggaaaacata tttaaataga        60
     gaagagcttg aagcgcactt ggcatctgta attagattag aaaatatagg agttttactt       120
     ggggcagggg catccatatc cgctggcggt aaaacaatga gcgatgtttg gaaaagcttt       180
     aaagatgatt atagtgattc tgctgattgg ttgcagaaaa aaacattctt caatgatggt       240
     agtatcaatg tagaagaatt attagataca ttagagattg ccgaaaagga atggattcga       300
     cagggaaaga caaagcttac taagcaatta caaaaagcca aagctgattt atatcgatca       360
     atcatcaaag catcagtgct acaagataaa tggtggaata gtcctcatct tgttgatctg       420
     gatgatggaa agttggattc tcatcgtgct ttattgcaag cattatgcgg atcacgacag       480
     gtcggtcaac cagcaccatg gatttttact acaaattatg atttagccat ggagtgggca       540
     ggggagacct tgggctggaa aattaataat ggatttgagg gattgcataa tcggattttt       600
     tcgccgcatg tttttgattt gggatactct aatttatcag caaggggtga agctcgattt       660
     ggaacttatg gattcttctt agcgaagcta cacggctcac tttcttggca ggaattggat       720
     ggagagtatt tagaataccc agcagccact atttggtcgg atattcaaaa ttttttagat       780
     aaaaaggata atcacaaatt acccatagtt tttccatcag ctgcaaaata tattcaaact       840
     gttgggtttg ttcttggtga gttgctcaga aggttcactg aatttttatc aaaatcacag       900
     acttgtctga ttactattgg atattcattt tccgattcac atttaaatca aattgtaaaa       960
     agagctttat taaatccaac attgcaattg gtgatttgtt tgcctgaact tgaaaagttt      1020
     gatggtaata acattaatat caataaatcg attcaatcga tattaaaact agagtcccca      1080
     caaattacaa ttattggcgg taaagagaaa gcattctttg attcattcgt tacatatctt      1140
     cctcagccag ttatatatga cgaatatgca ttgaaaatta agaaactgat caatgaaaat      1200
     aaagaacaaa atacgcctgc tcgcgaagat ataggtatag gagaaaatat gtga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page