(data stored in ACNUC7421 zone)

EMBL: CP000675.PE616

CP000675.PE616       Location/Qualifiers
FT   CDS_pept        647023..648783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2786"
FT                   /product="hypothetical protein"
FT                   /note="similarity to MJECL08"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2786"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56687"
FT                   /protein_id="ABQ56687.1"
FT                   /translation="MNIKGREPFGYVVAIEGSKVTLNLKDTYKGQFAAHRDGVSAVTEI
FT                   NGLFGIDGGNRLLVLRIISLLFLEPKEAHKYTTQKNRLDTEPLRQVLAVVVGHIKRKNE
FT                   ELNFMPDSLASPALGAEAFPLSDNELLAVVQPNIDKDKSIIIGTDTRGFDSIKVNINNM
FT                   LNRHTAVLGSTGQGKSCFIASMLQQMHKFPKPRIVIFDINGEYENAFVNKNDSVKTTKI
FT                   GGKEGYRIPYMALGRHGLSRLLMPSEKTQRPALTFAIDNLNKVKCFKNSSGVGLNDSDS
FT                   PIFFDDCRTGDAKSAWDGIEKLRNGQADFVSKWPKMSALSALVAESYSLKPDRNNSVTR
FT                   DAFLYSNVSPLITRIKRLVDDPLFTSIVDINEKDFIGNDNQGSWEQEGSKVVNDIFGCE
FT                   GSDWSIHIINLRDVAHDLMPLVLGALLELFAFELFNRGQEKSYPTLLVLEEAHHYLRQF
FT                   VGDDEGRHQNLAYERLAKEGRKFGLSLLISTQRPSEMSSTVLSQCGTWVVFRLTSEQDL
FT                   RSVSAASEWVDKLELNRIAGLPRQQALIFGSSFSVPIRIQTHNASPTPKSSDPDFNKWF
FT                   TDKNDSSGVE"
     gtgaacataa aaggtaggga gccatttggt tatgttgttg ccatcgaagg ctcaaaagtt        60
     acactgaacc ttaaagatac ttataaaggg caatttgcag cgcatcgtga tggagtgtcg       120
     gctgtaacag aaattaatgg cctcttcggc attgatggtg gaaatagact attagtatta       180
     cggataattt cattgctttt tcttgagcca aaagaggctc ataaatatac aactcaaaaa       240
     aatcgtttag atacggaacc attaagacag gttttagctg ttgttgttgg gcatataaag       300
     cgaaaaaatg aagagctaaa ttttatgcca gattcgttgg cttcacctgc tttaggtgct       360
     gaagctttcc cattaagtga caatgaatta cttgctgtag tccaacctaa catagataaa       420
     gacaaatcaa ttataatcgg aacagacact agaggatttg atagcataaa ggtaaatata       480
     aataatatgt tgaatcggca caccgctgtt ttaggttcaa caggtcaagg taaaagttgt       540
     tttattgcaa gtatgctgca acaaatgcat aaatttccaa agcccaggat tgttattttt       600
     gatatcaatg gtgagtatga aaatgctttt gtcaataaaa atgattcagt aaaaacaact       660
     aaaataggcg gtaaagaagg gtatagaatc ccatacatgg ctttaggtag gcatgggctt       720
     tcccgtttgc tgatgcctag tgaaaaaaca cagaggccag cattaacttt tgctatagat       780
     aatttgaata aagttaaatg ttttaagaat tcatctggtg ttggtttaaa tgatagtgat       840
     agccctatat tttttgatga ttgcagaacg ggtgacgcaa aaagcgcttg ggatgggata       900
     gaaaagctaa gaaatgggca ggctgacttt gtttccaaat ggccaaaaat gtcggcactt       960
     tctgctctcg tagcggaaag ctactcgctt aagcctgata gaaataatag tgtcacaaga      1020
     gatgctttct tatattccaa tgtttctccg ctaattacaa gaattaagcg cctagtcgat      1080
     gatccattat ttacaagtat tgttgatatt aatgaaaagg attttattgg caatgataac      1140
     caaggttctt gggagcaaga aggtagcaaa gttgttaatg atatatttgg atgtgagggt      1200
     agcgattggt ctattcatat tattaattta cgtgatgttg ctcacgattt gatgccgtta      1260
     gtacttggtg cactactaga attatttgca ttcgagcttt ttaatagagg acaagaaaag      1320
     agctatccaa cactacttgt gttagaagag gcgcatcatt atttgcgtca gtttgttggt      1380
     gatgacgaag ggaggcatca aaatctagct tatgaaagat tagctaaaga aggaagaaaa      1440
     ttcggtttaa gcttattaat cagtactcaa agaccttctg aaatgtcatc gacagttttg      1500
     tcacaatgcg gaacttgggt agtatttaga ttgacttcag agcaagatct aagatcagta      1560
     agtgcagcta gtgaatgggt agataaacta gaattaaata gaatcgcagg tttgccgagg      1620
     cagcaagcgc ttatttttgg ttcaagtttt tcagttccaa taaggatcca aacacacaat      1680
     gcgagcccaa cgccaaaatc aagcgatcct gactttaata aatggtttac tgataaaaat      1740
     gattcgtctg gagttgaata a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page