(data stored in ACNUC7421 zone)

EMBL: CP000675.PE618

CP000675.PE618       Location/Qualifiers
FT   CDS_pept        complement(652210..652533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2784"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56685"
FT                   /protein_id="ABQ56685.1"
FT                   /translation="MTFYYEEKLIENDPLKRIVEKSNISVLPWNQASFMNKHEKQTMSG
FT                   RSAFGLYNGVSIVSKFNNKNYIFVLATEHRDHDLARYLLLEKNYELKKLMHGCITSLEG
FT                   WCG"
     atgactttct attatgaaga aaaattaatc gaaaatgatc cattaaaaag aattgtagaa        60
     aagtcaaaca tttcagtact cccatggaat caagccagtt ttatgaataa gcatgaaaaa       120
     caaaccatgt ctggccgatc cgcttttggg ctttataatg gtgtctcgat tgttagtaaa       180
     ttcaataaca aaaattacat atttgtattg gcaactgaac atagagatca tgacttagca       240
     aggtatttgc tattggaaaa aaattatgaa ctaaagaaat taatgcatgg gtgtataacc       300
     tctttagaag gatggtgtgg ttag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page